• Gene id: 5520

Gene Summary

• Gene Symbol: PPP2R2A   Gene   UCSC   Ensembl
• Aliases: B55A, B55ALPHA, PR52A, PR55A, PR55alpha
• Gene name: protein phosphatase 2 regulatory subunit Balpha
• Alternate names: serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform, protein phosphatase 2, regulatory subunit B, alpha,
• Gene location: 8p21.2 (26291507: 26372679)     Exons: 15     NC_000008.11
• Gene summary(Entrez): The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
• OMIM: 604941

Protein Summary

• Protein general information: P63151  
  • Name: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (PP2A subunit B isoform B55 alpha) (PP2A subunit B isoform PR55 alpha) (PP2A subunit B isoform R2 alpha) (PP2A subunit B isoform alpha)
  • Length: 447  
  • Mass: 51692
  • Tissue specificity: Expressed in all tissues examined. {ECO
• Sequence:

  MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYS
  TFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVT
  TLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEEL
  TEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
  MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKR
  DITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN

• Structural information:
  • Interpro: IPR000009  IPR018067  IPR015943  IPR001680  IPR036322  
  • Prosite: PS01024 PS01025
  • PDB: 3DW8
  • PDBsum: 3DW8
  • DIP: 29398
  • STRING: ENSP00000325074
• Other Databases: GeneCards:  PPP2R2A  Malacards:  PPP2R2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070262	peptidyl-serine dephosphorylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0019888	protein phosphatase regulator activity	IBA	molecular function
GO:0000159	protein phosphatase type 2A complex	IBA	cellular component
GO:0000159	protein phosphatase type 2A complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000159	protein phosphatase type 2A complex	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0007084	mitotic nuclear envelope reassembly	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048156	tau protein binding	IEA	molecular function
GO:0043278	response to morphine	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0051721	protein phosphatase 2A binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0019888	protein phosphatase regulator activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0000159	protein phosphatase type 2A complex	IDA	cellular component
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04530	Tight junction
hsa04390	Hippo signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04728	Dopaminergic synapse
hsa05160	Hepatitis C
hsa04071	Sphingolipid signaling pathway
hsa04152	AMPK signaling pathway
hsa03015	mRNA surveillance pathway
hsa05142	Chagas disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray