• Gene id: 55199

Gene Summary

• Gene Symbol: FAM86C1P   Gene   UCSC   Ensembl
• Aliases: FAM86C, FAM86C1
• Gene name: family with sequence similarity 86 member C1, pseudogene
• Alternate names: protein FAM86C1, family with sequence similarity 86 member C1, family with sequence similarity 86, member C,
• Gene location: 11q13.4 (: )     Exons:     
• OMIM: 601788

Protein Summary

• Protein general information: Q9NVL1  
  • Name: Protein FAM86C1 (EC 2.1.1. ) (Protein FAM86C)
  • Length: 165  
  • Mass: 18454
• Sequence:

  MAPEENAGSELLLQSFKRRFLAARALRSFRWQSLEAKLRDSSDSELLRDILQKHEAVHTEPLDELYEVLVETLMA
  KESTQGHRSYLLTCCIAQKPSCRWSGSCGGWLPAGSTSGLLNSTWPLPSATQRCASCSPPSYAGLGSDGKRKLIM
  TRNCFPTESTWRWQS

• Structural information:
  • Interpro: IPR029426  
  • STRING: ENSP00000352182
• Other Databases: GeneCards:  FAM86C1P  Malacards:  FAM86C1P

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0016279	protein-lysine N-methyltransferase activity	IBA	molecular function
GO:0018023	peptidyl-lysine trimethylation	IBA	biological process
GO:0032259	methylation	IBA	biological process
GO:0008168	methyltransferase activity	IBA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881