• Gene id: 55197

Gene Summary

• Gene Symbol: RPRD1A   Gene   UCSC   Ensembl
• Aliases: HsT3101, P15RS
• Gene name: regulation of nuclear pre-mRNA domain containing 1A
• Alternate names: regulation of nuclear pre-mRNA domain-containing protein 1A, CDKN2B-related protein, Cyclin-dependent kinase inhibitor 2B-related protein (p15INK4B-related protein), cyclin-dependent kinase 2B-inhibitor-related protein, p15INK4B-related protein,
• Gene location: 18q12.2 (36067593: 35982384)     Exons: 13     NC_000018.10
• Gene summary(Entrez): This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also
• OMIM: 180721

Protein Summary

• Protein general information: Q96P16  
  • Name: Regulation of nuclear pre mRNA domain containing protein 1A (Cyclin dependent kinase inhibitor 2B related protein) (p15INK4B related protein)
  • Length: 312  
  • Mass: 35720
• Sequence:

  MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNSKRKGP
  EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENEN
  CSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLAD
  YNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHM
  HLPFAGDIYSED

• Structural information:
  • Protein Domains: (2..13-)
    (/note="CID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00724"-)
  • Interpro: IPR006569  IPR032337  IPR008942  IPR006903  
  • Prosite: PS51391
  • PDB: 4JXT 4NAC
  • PDBsum: 4JXT 4NAC
  • DIP: 50901
  • STRING: ENSP00000381984
• Other Databases: GeneCards:  RPRD1A  Malacards:  RPRD1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000993	RNA polymerase II complex binding	IBA	molecular function
GO:0016591	RNA polymerase II, holoenzyme	IBA	cellular component
GO:0031124	mRNA 3'-end processing	IBA	biological process
GO:0016591	RNA polymerase II, holoenzyme	IDA	cellular component
GO:0070940	dephosphorylation of RNA polymerase II C-terminal domain	IMP	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000993	RNA polymerase II complex binding	IBA	molecular function
GO:0016591	RNA polymerase II, holoenzyme	IBA	cellular component
GO:0031124	mRNA 3'-end processing	IBA	biological process
GO:0016591	RNA polymerase II, holoenzyme	IDA	cellular component
GO:0070940	dephosphorylation of RNA polymerase II C-terminal domain	IMP	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881