• Gene id: 5519

Gene Summary

• Gene Symbol: PPP2R1B   Gene   UCSC   Ensembl
• Aliases: PP2A-Abeta, PR65B
• Gene name: protein phosphatase 2 scaffold subunit Abeta
• Alternate names: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform, PP2A, subunit A, PR65-beta isoform, PP2A, subunit A, R1-beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform, protein phosphatase 2, regulatory ,
• Gene location: 11q23.1 (111766388: 111690272)     Exons: 21     NC_000011.10
• Gene summary(Entrez): This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co
• OMIM: 603113

Protein Summary

• Protein general information: P30154  
  • Name: Serine/threonine protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65 beta) (PP2A subunit A isoform R1 beta)
  • Length: 601  
  • Mass: 66214
• Sequence:

  MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDED
  EVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASG
  DWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLA
  SDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ
  NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIE
  HLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEF
  FDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACG
  QEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
  A

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR000357  IPR021133  
  • Prosite: PS50077
  • DIP: 36616
  • STRING: ENSP00000311344
• Other Databases: GeneCards:  PPP2R1B  Malacards:  PPP2R1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008287	protein serine/threonine phosphatase complex	IBA	cellular component
GO:0000159	protein phosphatase type 2A complex	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	contributes to
GO:0005737	cytoplasm	IBA	cellular component
GO:0019888	protein phosphatase regulator activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IMP	biological process
GO:0060561	apoptotic process involved in morphogenesis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04530	Tight junction
hsa04390	Hippo signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04728	Dopaminergic synapse
hsa05160	Hepatitis C
hsa04114	Oocyte meiosis
hsa04071	Sphingolipid signaling pathway
hsa04152	AMPK signaling pathway
hsa03015	mRNA surveillance pathway
hsa04350	TGF-beta signaling pathway
hsa05142	Chagas disease
hsa04730	Long-term depression

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)