• Gene id: 55186

Gene Summary

• Gene Symbol: SLC25A36   Gene   UCSC   Ensembl
• Aliases: PNC2
• Gene name: solute carrier family 25 member 36
• Alternate names: solute carrier family 25 member 36, epididymis secretory sperm binding protein, solute carrier family 25 (pyrimidine nucleotide carrier ), member 36,
• Gene location: 3q23 (140941835: 140980994)     Exons: 8     NC_000003.12
• OMIM: 616149

Protein Summary

• Protein general information: Q96CQ1  
  • Name: Solute carrier family 25 member 36
  • Length: 311  
  • Mass: 34283
  • Tissue specificity: Expressed at moderate level. {ECO
• Sequence:

  MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKE
  GPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDA
  RNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASD
  FVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMA
  TYELVVYLLNG

• Structural information:
  • Interpro: IPR002067  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000320688
• Other Databases: GeneCards:  SLC25A36  Malacards:  SLC25A36

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990519	pyrimidine nucleotide import into mitochondrion	IBA	biological process
GO:0015218	pyrimidine nucleotide transmembrane transporter activity	IBA	molecular function
GO:0007005	mitochondrion organization	IDA	biological process
GO:0006864	pyrimidine nucleotide transport	IDA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0000002	mitochondrial genome maintenance	IDA	biological process
GO:0015218	pyrimidine nucleotide transmembrane transporter activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005347	ATP transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0015867	ATP transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)