Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 5518
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol PPP2R1A   Gene   UCSC   Ensembl
Aliases MRD36, PP2A-Aalpha, PP2AA, PP2AAALPHA, PR65A
Gene name protein phosphatase 2 scaffold subunit Aalpha
Alternate names serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform, PP2A subunit A isoform PR65-alpha, PP2A subunit A isoform R1-alpha, medium tumor antigen-associated 61 KDA protein, protein phosphatase 2 (formerly 2A), regulatory subunit A (P,
Gene location 19q13.41 (52190051: 52229517)     Exons: 16     NC_000019.10
Gene summary(Entrez) This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co
OMIM 610033

Protein Summary
Protein general information P30153  

Name: Serine/threonine protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Medium tumor antigen associated 61 kDa protein) (PP2A subunit A isoform PR65 alpha) (PP2A subunit A isoform R1 alpha)

Length: 589  Mass: 65309

Sequence MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGT
FTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGL
FSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAV
EACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKD
ECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAW
LVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV
LRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
Structural information
Interpro:  IPR011989  IPR016024  IPR000357  IPR021133  IPR031090  
Prosite:   PS50077

PDB:  		 1B3U 2IE3 2IE4 2NPP 2NYL 2NYM 2PKG 3C5W 3DW8 3K7V 3K7W 4I5L 4I5N 4LAC 5W0W 6IUR
PDBsum:   1B3U 2IE3 2IE4 2NPP 2NYL 2NYM 2PKG 3C5W 3DW8 3K7V 3K7W 4I5L 4I5N 4LAC 5W0W 6IUR

DIP:  
29394
MINT:  
STRING:   ENSP00000324804
Other Databases GeneCards:  PPP2R1A  Malacards:  PPP2R1A

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0008287 protein serine/threonine
phosphatase complex
 IBA cellular component
GO:0000159 protein phosphatase type
2A complex
 IBA cellular component
GO:0004722 protein serine/threonine
phosphatase activity
 IBA contributes to
GO:0005737 cytoplasm
 IBA cellular component
GO:0019888 protein phosphatase regul
ator activity
 IBA molecular function
GO:0007059 chromosome segregation
 IDA biological process
GO:0000775 chromosome, centromeric r
egion
 IDA cellular component
GO:0000159 protein phosphatase type
2A complex
 IDA cellular component
GO:0000159 protein phosphatase type
2A complex
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0019888 protein phosphatase regul
ator activity
 IEA molecular function
GO:0065003 protein-containing comple
x assembly
 IEA biological process
GO:0042995 cell projection
 IEA cellular component
GO:0005694 chromosome
 IEA cellular component
GO:0007059 chromosome segregation
 IEA biological process
GO:0005886 plasma membrane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0000775 chromosome, centromeric r
egion
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0007084 mitotic nuclear envelope
reassembly
 TAS biological process
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological process
GO:0000184 nuclear-transcribed mRNA
catabolic process, nonsen
se-mediated decay
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0010389 regulation of G2/M transi
tion of mitotic cell cycl
e
 TAS biological process
GO:0097711 ciliary basal body-plasma
membrane docking
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:2001241 positive regulation of ex
trinsic apoptotic signali
ng pathway in absence of
ligand
 IEA biological process
GO:1903538 regulation of meiotic cel
l cycle process involved
in oocyte maturation
 IEA biological process
GO:0098978 glutamatergic synapse
 IEA cellular component
GO:0070262 peptidyl-serine dephospho
rylation
 IEA biological process
GO:0007143 female meiotic nuclear di
vision
 IEA biological process
GO:0005829 cytosol
 IEA cellular component
GO:0051754 meiotic sister chromatid
cohesion, centromeric
 IEA biological process
GO:0051306 mitotic sister chromatid
separation
 IEA biological process
GO:0051232 meiotic spindle elongatio
n
 IEA biological process
GO:0045202 synapse
 IEA cellular component
GO:0004722 protein serine/threonine
phosphatase activity
 IEA molecular function
GO:0000159 protein phosphatase type
2A complex
 IEA cellular component
GO:0016328 lateral plasma membrane
 IEA cellular component
GO:0030425 dendrite
 IEA cellular component
GO:0000775 chromosome, centromeric r
egion
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0043666 regulation of phosphoprot
ein phosphatase activity
 IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
 IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
 IEA biological process
GO:0005634 nucleus
 IDA cellular component
GO:0070062 extracellular exosome
 HDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0030155 regulation of cell adhesi
on
 NAS biological process
GO:1990405 protein antigen binding
 IPI molecular function
GO:0046982 protein heterodimerizatio
n activity
 IPI molecular function
GO:0019932 second-messenger-mediated
signaling
 NAS biological process
GO:0016020 membrane
 NAS cellular component
GO:0019888 protein phosphatase regul
ator activity
 TAS molecular function
GO:0008380 RNA splicing
 NAS biological process
GO:0006672 ceramide metabolic proces
s
 NAS biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 NAS biological process
GO:0005634 nucleus
 NAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000188 inactivation of MAPK acti
vity
 NAS biological process
GO:0000159 protein phosphatase type
2A complex
 TAS cellular component
GO:0030308 negative regulation of ce
ll growth
 NAS biological process
GO:0015630 microtubule cytoskeleton
 NAS cellular component
GO:0010033 response to organic subst
ance
 NAS biological process
GO:0006470 protein dephosphorylation
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:1990405 protein antigen binding
 IPI molecular function
GO:0045595 regulation of cell differ
entiation
 NAS biological process
GO:0042532 negative regulation of ty
rosine phosphorylation of
STAT protein
 NAS biological process
GO:0040008 regulation of growth
 NAS biological process
GO:0030111 regulation of Wnt signali
ng pathway
 NAS biological process
GO:0006915 apoptotic process
 TAS biological process
GO:0065003 protein-containing comple
x assembly
 TAS biological process
GO:0006275 regulation of DNA replica
tion
 NAS biological process
GO:0005739 mitochondrion
 NAS cellular component
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa05165Human papillomavirus infection
hsa04530Tight junction
hsa04390Hippo signaling pathway
hsa04261Adrenergic signaling in cardiomyocytes
hsa04728Dopaminergic synapse
hsa05160Hepatitis C
hsa04114Oocyte meiosis
hsa04071Sphingolipid signaling pathway
hsa04152AMPK signaling pathway
hsa03015mRNA surveillance pathway
hsa04350TGF-beta signaling pathway
hsa05142Chagas disease
hsa04730Long-term depression

Diseases

Expand All | Collapse All
Associated diseases References
Autosomal dominant mental retardation KEGG:H00773
Autosomal dominant mental retardation KEGG:H00773
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract