• Gene id: 55179

Gene Summary

• Gene Symbol: FAIM   Gene   UCSC   Ensembl
• Aliases: FAIM1
• Gene name: Fas apoptotic inhibitory molecule
• Alternate names: fas apoptotic inhibitory molecule 1,
• Gene location: 3q22.3 (138608098: 138633375)     Exons: 8     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
• OMIM: 617535

Protein Summary

• Protein general information: Q9NVQ4  
  • Name: Fas apoptotic inhibitory molecule 1
  • Length: 179  
  • Mass: 20215
• Sequence:

  MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAY
  EYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCY
  IKAVSSGKRKEGIIHTLIVDNREIPEIAS

• Structural information:
  • Interpro: IPR010695  IPR038513  
  • PDB: 2KW1 3MX7
  • PDBsum: 2KW1 3MX7
  • STRING: ENSP00000342805
• Other Databases: GeneCards:  FAIM  Malacards:  FAIM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IBA	biological process
GO:0050769	positive regulation of neurogenesis	IBA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)