• Gene id: 55171

Gene Summary

• Gene Symbol: TBCCD1   Gene   UCSC   Ensembl
• Gene name: TBCC domain containing 1
• Alternate names: TBCC domain-containing protein 1,
• Gene location: 3q27.3 (186570542: 186546066)     Exons: 9     NC_000003.12
• OMIM: 608086

Protein Summary

• Protein general information: Q9NVR7  
  • Name: TBCC domain containing protein 1
  • Length: 557  
  • Mass: 63530
• Sequence:

  MDQSRVLLWVKAEPFIVGALQVPPPSKFSLHYLRKISTYVQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLY
  FEIFDSLSMKTPEERLEWSEVLSNCMSEEEVEKQRNQLSVDTLQFLLFLYIQQLNKVSLRTSLIGEEWPSPRNKS
  QSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQLTASFHSTHSSLVSREAVVALSFLIEGTISRARK
  IYPLHELALWQPLHADSGFSKISKTFSFYKLETWLRSCLTGNPFGTSACLKSGKKLAWAHQVEGTTKRAKIACNT
  HVAPRMHRLVVMSQVYKQTLAKSSDTLAGAHVKIHRCNESFIYLLSPLRSVTIEKCRNSIFVLGPVGTTLHLHSC
  DNVKVIAVCHRLSISSTTGCIFHVLTPTRPLILSGNQTVTFAPFHTHYPMLEDHMARTGLATVPNYWDNPMVVCR
  ENSDTRVFQLLPPCEFYVFIIPFEMEGDTTEIPGGLPSVYQKALGQREQKIQIWQKTVKEAHLTKDQRKQFQVLV
  ENKFYEWLINTGHRQQLDSLVPPAAGSKQAAG

• Structural information:
  • Protein Domains: (290..43-)
    (/note="C-CAP/cofactor-C-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00659"-)
  • Interpro: IPR017901  IPR016098  IPR036223  IPR006599  IPR039589   IPR012945  
  • Prosite: PS51329
  • STRING: ENSP00000411253
• Other Databases: GeneCards:  TBCCD1  Malacards:  TBCCD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031616	spindle pole centrosome	IDA	cellular component
GO:0051684	maintenance of Golgi location	IMP	biological process
GO:0051661	maintenance of centrosome location	IMP	biological process
GO:0030334	regulation of cell migration	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000922	spindle pole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0031616	spindle pole centrosome	IDA	cellular component
GO:0051684	maintenance of Golgi location	IMP	biological process
GO:0051661	maintenance of centrosome location	IMP	biological process
GO:0030334	regulation of cell migration	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000922	spindle pole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881