• Gene id: 55170

Gene Summary

• Gene Symbol: PRMT6   Gene   UCSC   Ensembl
• Aliases: HRMT1L6
• Gene name: protein arginine methyltransferase 6
• Alternate names: protein arginine N-methyltransferase 6, HMT1 hnRNP methyltransferase-like 6, heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6, histone-arginine N-methyltransferase PRMT6,
• Gene location: 1p13.3 (107056644: 107059293)     Exons: 1     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated a
• OMIM: 608274

SNPs

rs3791185

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.107058247G>A
NC_000001.10   g.107600869G>A
NM_018137.2   c.*404G>A
NM_018137.3   c.*404G>A|SEQ=[G/A]|GENE=PRMT6

rs2232015

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.107056636A>G
NC_000001.11   g.107056636A>T
NC_000001.10   g.107599258A>G
NC_000001.10   g.107599258A>T|SEQ=[A/G/T]|GENE=PRMT6

Protein Summary

• Protein general information: Q96LA8  
  • Name: Protein arginine N methyltransferase 6 (EC 2.1.1.319) (Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 6) (Histone arginine N methyltransferase PRMT6)
  • Length: 375  
  • Mass: 41,938
• Sequence:

  MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGIL
  RNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVD
  AIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGF
  ATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
  SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED

• Structural information:
  • Protein Domains: SAM-dependent (44-374)
  • Interpro: IPR025799  IPR029063  
  • Prosite: PS51678
  • PDB: 4HC4 4QPP 4QQK 4Y2H 4Y30 5E8R 5EGS 5HZM 5WCF
  • PDBsum: 4HC4 4QPP 4QQK 4Y2H 4Y30 5E8R 5EGS 5HZM 5WCF
  • STRING: ENSP00000359095
• Other Databases: GeneCards:  PRMT6  Malacards:  PRMT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006284	base-excision repair	TAS	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0008469	histone-arginine N-methyltransferase activity	IDA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0016049	cell growth	IEA	biological process
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016571	histone methylation	IDA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0034970	histone H3-R2 methylation	IDA	biological process
GO:0034970	histone H3-R2 methylation	IDA	biological process
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0042054	histone methyltransferase activity	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0043985	histone H4-R3 methylation	IEA	biological process
GO:0044020	histone methyltransferase activity (H4-R3 specific)	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0070611	histone methyltransferase activity (H3-R2 specific)	IDA	molecular function
GO:0070611	histone methyltransferase activity (H3-R2 specific)	IDA	molecular function
GO:0070612	histone methyltransferase activity (H2A-R3 specific)	IDA	molecular function
GO:0090398	cellular senescence	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006284	base-excision repair	TAS	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006479	protein methylation	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0008469	histone-arginine N-methyltransferase activity	IDA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0016049	cell growth	IEA	biological process
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016571	histone methylation	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0032259	methylation	IEA	biological process
GO:0034970	histone H3-R2 methylation	IDA	biological process
GO:0034970	histone H3-R2 methylation	IDA	biological process
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0042054	histone methyltransferase activity	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0043985	histone H4-R3 methylation	IEA	biological process
GO:0044020	histone methyltransferase activity (H4-R3 specific)	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0070611	histone methyltransferase activity (H3-R2 specific)	IDA	molecular function
GO:0070611	histone methyltransferase activity (H3-R2 specific)	IDA	molecular function
GO:0070612	histone methyltransferase activity (H2A-R3 specific)	IDA	molecular function
GO:0090398	cellular senescence	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006284	base-excision repair	TAS	biological process
GO:0008469	histone-arginine N-methyltransferase activity	IDA	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016571	histone methylation	IDA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0034970	histone H3-R2 methylation	IDA	biological process
GO:0034970	histone H3-R2 methylation	IDA	biological process
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0042054	histone methyltransferase activity	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0044020	histone methyltransferase activity (H4-R3 specific)	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0070611	histone methyltransferase activity (H3-R2 specific)	IDA	molecular function
GO:0070611	histone methyltransferase activity (H3-R2 specific)	IDA	molecular function
GO:0070612	histone methyltransferase activity (H2A-R3 specific)	IDA	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 22197933
Spermatogenesis defects	MIK: 24303009
Oligozoospermia	MIK: 24303009
Azoospermia	MIK: 24303009
Male infertility	MIK: 30863997
Non-obstructive azoospermia	MIK: 22197933
Spermatogenic defects	MIK: 26690413
Male infertility	MIK: 26690413
Azoospermia	MIK: 24303009
Oligozoospermia	MIK: 24303009
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24303009	Spermatogenic impairment, azoospermia, oligozoospermia	rs3791185 and rs2232015 in PRMT6, rs146039840 and rs11046992 in Sox5, rs1129332 in PEX10, rs3197744 in SIRPA, rs1048055 in SIRPG		1376 (784 individuals with oligozoospermia, 592 healthy controls)	Male infertility
22197933	Non-obstructive azoospermia	PRMT6 (rs12097821), PEX10 (rs2477686), SOX5 (rs10842262)	Chinese	8661 (2,927 individuals with NOA, 5,734 controls)	Male infertility	PRMT6 PEX10 SOX5
26690413	Role in spermatogenesis,Male infertility				Male infertility
30863997	Male infertility	rs12097821	Chinese	1351 (631 infertile men (NOA and oligozoospermia) and 720 healthy fertile men)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)