• Gene id: 55168

Gene Summary

• Gene Symbol: MRPS18A   Gene   UCSC   Ensembl
• Aliases: HumanS18b, MRP-S18-3, MRP-S18-a, MRPS18-3, S18bmt, S18mt-a
• Gene name: mitochondrial ribosomal protein S18A
• Alternate names: 39S ribosomal protein S18a, mitochondrial, 28S ribosomal protein S18-3, mitochondrial, 28S ribosomal protein S18a, mitochondrial, 39S ribosomal protein S18-3, mitochondrial, mitochondrial large ribosomal subunit protein bS18a, mitochondrial large ribosomal sub,
• Gene location: 6p21.1 (43687811: 43671196)     Exons: 6     NC_000006.12
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611981

Protein Summary

• Protein general information: Q9NVS2  
  • Name: 39S ribosomal protein S18a, mitochondrial (MRP S18 a) (Mrps18a) (S18mt a) (39S ribosomal protein S18 3, mitochondrial) (MRP S18 3) (Mitochondrial large ribosomal subunit protein bS18a) (Mitochondrial large ribosomal subunit protein mL66)
  • Length: 196  
  • Mass: 22184
• Sequence:

  MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRW
  NLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRY
  LTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH

• Structural information:
  • Interpro: IPR001648  IPR036870  
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000361206
• Other Databases: GeneCards:  MRPS18A  Malacards:  MRPS18A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070181	small ribosomal subunit rRNA binding	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0006412	translation	NAS	biological process
GO:0032543	mitochondrial translation	ISS	biological process
GO:0003735	structural constituent of ribosome	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881