• Gene id: 55163

Gene Summary

• Gene Symbol: PNPO   Gene   UCSC   Ensembl
• Aliases: HEL-S-302, PDXPO
• Gene name: pyridoxamine 5'-phosphate oxidase
• Alternate names: pyridoxine-5'-phosphate oxidase, epididymis secretory protein Li 302, epididymis secretory sperm binding protein, pyridoxal 5'-phosphate synthase, pyridoxamine-phosphate oxidase, pyridoxine 5'-phosphate oxidase,
• Gene location: 17q21.32 (47941523: 47949307)     Exons: 8     NC_000017.11
• Gene summary(Entrez): The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neuro
• OMIM: 608944

Protein Summary

• Protein general information: Q9NVS9  
  • Name: Pyridoxine 5' phosphate oxidase (EC 1.4.3.5) (Pyridoxamine phosphate oxidase)
  • Length: 261  
  • Mass: 29988
• Sequence:

  MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDI
  GEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLP
  EEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNR
  LHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP

• Structural information:
  • Interpro: IPR000659  IPR019740  IPR011576  IPR019576  IPR012349  
  • Prosite: PS01064
  • PDB: 1NRG 3HY8 6H00
  • PDBsum: 1NRG 3HY8 6H00
  • STRING: ENSP00000225573
• Other Databases: GeneCards:  PNPO  Malacards:  PNPO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042823	pyridoxal phosphate biosynthetic process	IBA	biological process
GO:0004733	pyridoxamine-phosphate oxidase activity	IBA	molecular function
GO:0008615	pyridoxine biosynthetic process	IEA	biological process
GO:0010181	FMN binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004733	pyridoxamine-phosphate oxidase activity	IEA	molecular function
GO:0016638	oxidoreductase activity, acting on the CH-NH2 group of donors	IEA	molecular function
GO:0008615	pyridoxine biosynthetic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004733	pyridoxamine-phosphate oxidase activity	IEA	molecular function
GO:0042816	vitamin B6 metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004733	pyridoxamine-phosphate oxidase activity	IEA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042823	pyridoxal phosphate biosynthetic process	IDA	biological process
GO:0010181	FMN binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0030170	pyridoxal phosphate binding	IDA	molecular function
GO:0004733	pyridoxamine-phosphate oxidase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00750	Vitamin B6 metabolism

Diseases

Associated diseases	References
Pyridoxamine-5'-phosphate oxidase	KEGG:H01124
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray