• Gene id: 55161

Gene Summary

• Gene Symbol: TMEM33   Gene   UCSC   Ensembl
• Aliases: 1600019D15Rik, Pom33, SHINC-3, SHINC3
• Gene name: transmembrane protein 33
• Alternate names: transmembrane protein 33,
• Gene location: 4p13 (41935119: 41960802)     Exons: 8     NC_000004.12

Protein Summary

• Protein general information: P57088  
  • Name: Transmembrane protein 33 (Protein DB83) (SHINC 3)
  • Length: 247  
  • Mass: 27978
  • Tissue specificity: Prostate cancer and several cancer cell lines (at protein level). Widely expressed. Expressed at higher levels in endocrine-resistant breast cancer cells as compared to endocrine-sensitive breast cancer cells. Expressed at higher level
• Sequence:

  MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLP
  HFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLPLLRSVLDKLS
  ANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACP
  LFVRRLCLQSIAFISRLAPTVP

• Structural information:
  • Interpro: IPR005344  
  • STRING: ENSP00000422473
• Other Databases: GeneCards:  TMEM33  Malacards:  TMEM33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0061024	membrane organization	IBA	biological process
GO:0071786	endoplasmic reticulum tubular network organization	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	IDA	biological process
GO:1903371	regulation of endoplasmic reticulum tubular network organization	IDA	biological process
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:1903899	positive regulation of PERK-mediated unfolded protein response	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0042470	melanosome	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881