• Gene id: 55154

Gene Summary

• Gene Symbol: MSTO1   Gene   UCSC   Ensembl
• Aliases: LST005, MMYAT, MST
• Gene name: misato mitochondrial distribution and morphology regulator 1
• Alternate names: protein misato homolog 1, misato 1, mitochondrial distribution and morphology regulator, misato homolog 1,
• Gene location: 1q22 (155610169: 155614966)     Exons: 14     NC_000001.11
• OMIM: 300298

Protein Summary

• Protein general information: Q9BUK6  
  • Name: Protein misato homolog 1
  • Length: 570  
  • Mass: 61835
  • Tissue specificity: Present in all cell lines tested (at protein level). Widely expressed. {ECO
• Sequence:

  MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGS
  LSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATT
  PKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYL
  QGFQILCDLHDGFSGVGAKAAELLQDEYSGRGIITWGLLPGPYHRGEAQRNIYRLLNTAFGLVHLTAHSSLVCPL
  SLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRLCSSPVSMVHLADMLSFCGKKVVTAGAIIP
  FPLAPGQSLPDSLMQFGGATPWTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEIL
  AQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALAR
  DLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD

• Structural information:
  • Interpro: IPR029209  IPR019605  IPR036525  
  • STRING: ENSP00000245564
• Other Databases: GeneCards:  MSTO1  Malacards:  MSTO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0000002	mitochondrial genome maintenance	IBA	biological process
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0048311	mitochondrion distribution	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0048311	mitochondrion distribution	IMP	biological process
GO:0007005	mitochondrion organization	IMP	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R