• Gene id: 5515

Gene Summary

• Gene Symbol: PPP2CA   Gene   UCSC   Ensembl
• Aliases: NEDLBA, PP2Ac, PP2CA, PP2Calpha, RP-C
• Gene name: protein phosphatase 2 catalytic subunit alpha
• Alternate names: serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, replication protein C, serine/threonine protein,
• Gene location: 5q31.1 (134226072: 134194331)     Exons: 8     NC_000005.10
• Gene summary(Entrez): This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which
• OMIM: 176915

Protein Summary

• Protein general information: P67775  
  • Name: Serine/threonine protein phosphatase 2A catalytic subunit alpha isoform (PP2A alpha) (EC 3.1.3.16) (Replication protein C) (RP C)
  • Length: 309  
  • Mass: 35594
• Sequence:

  MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKS
  PDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLF
  DYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDIS
  ETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
  TRRTPDYFL

• Structural information:
  • Interpro: IPR004843  IPR029052  IPR006186  
  • Prosite: PS00125
  • PDB: 2IAE 2IE3 2IE4 2NPP 2NYL 2NYM 3C5W 3DW8 3FGA 3K7V 3K7W 3P71 4I5L 4I5N 4IYP 4LAC 5W0W
  • PDBsum: 2IAE 2IE3 2IE4 2NPP 2NYL 2NYM 3C5W 3DW8 3FGA 3K7V 3K7W 3P71 4I5L 4I5N 4IYP 4LAC 5W0W
  • DIP: 29395
  • STRING: ENSP00000418447
• Other Databases: GeneCards:  PPP2CA  Malacards:  PPP2CA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0004722	protein serine/threonine phosphatase activity	ISS	molecular function
GO:1904526	regulation of microtubule binding	NAS	biological process
GO:1904528	positive regulation of microtubule binding	ISS	biological process
GO:0070262	peptidyl-serine dephosphorylation	TAS	biological process
GO:0010288	response to lead ion	ISS	biological process
GO:0010288	response to lead ion	TAS	biological process
GO:0035970	peptidyl-threonine dephosphorylation	TAS	biological process
GO:0001932	regulation of protein phosphorylation	NAS	biological process
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0000159	protein phosphatase type 2A complex	IDA	cellular component
GO:0000159	protein phosphatase type 2A complex	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0007084	mitotic nuclear envelope reassembly	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0050811	GABA receptor binding	IEA	molecular function
GO:0000159	protein phosphatase type 2A complex	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007498	mesoderm development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0010719	negative regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0030308	negative regulation of cell growth	NAS	biological process
GO:0030155	regulation of cell adhesion	NAS	biological process
GO:0010033	response to organic substance	NAS	biological process
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045595	regulation of cell differentiation	NAS	biological process
GO:0030111	regulation of Wnt signaling pathway	NAS	biological process
GO:0019932	second-messenger-mediated signaling	NAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006275	regulation of DNA replication	NAS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0000188	inactivation of MAPK activity	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0015630	microtubule cytoskeleton	NAS	cellular component
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	NAS	biological process
GO:0040008	regulation of growth	NAS	biological process
GO:0016020	membrane	NAS	cellular component
GO:0008380	RNA splicing	NAS	biological process
GO:0006672	ceramide metabolic process	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0005739	mitochondrion	NAS	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0000159	protein phosphatase type 2A complex	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04530	Tight junction
hsa04390	Hippo signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04140	Autophagy - animal
hsa04728	Dopaminergic synapse
hsa05160	Hepatitis C
hsa04114	Oocyte meiosis
hsa04071	Sphingolipid signaling pathway
hsa04152	AMPK signaling pathway
hsa03015	mRNA surveillance pathway
hsa04350	TGF-beta signaling pathway
hsa05142	Chagas disease
hsa04730	Long-term depression
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Prostate cancer	PMID:18336616
Parkinson's disease	PMID:24395787
congestive heart failure	PMID:14567976
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881