• Gene id: 55147

Gene Summary

• Gene Symbol: RBM23   Gene   UCSC   Ensembl
• Aliases: CAPERbeta, PP239, RNPC4
• Gene name: RNA binding motif protein 23
• Alternate names: probable RNA-binding protein 23, CAPER beta, RNA-binding region (RNP1, RRM) containing 4, RNA-binding region-containing protein 4, coactivator of activating protein-1 and estrogen recep- tors beta, splicing factor SF2,
• Gene location: 14q11.2 (22919181: 22893203)     Exons: 17     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the U2AF-like family of RNA binding proteins. This protein interacts with some steroid nuclear receptors, localizes to the promoter of a steroid- responsive gene, and increases transcription of steroid-responsive transcriptio
• OMIM: 0

Protein Summary

• Protein general information: Q86U06  
  • Name: Probable RNA binding protein 23 (CAPER beta) (CAPERbeta) (RNA binding motif protein 23) (RNA binding region containing protein 4) (Splicing factor SF2)
  • Length: 439  
  • Mass: 48731
  • Tissue specificity: Highly expressed in placenta, liver, skeletal muscle, heart and kidney (PubMed
• Sequence:

  MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSKKKRSRSHNKSRDRKR
  SRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSP
  VREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIG
  LTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDT
  GRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDITFPDGDQELDLGSAGGRFQLMAKLAE
  GAGIQLPSTAAAAAAAAAQAAALQLNGAVPLGALNPAALTALSPALNLASQCFQLSSLFTPQTM

• Structural information:
  • Protein Domains: (166..24-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (263..34-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR029123  IPR006509  IPR000504  
  • Prosite: PS50102
  • PDB: 2CQ4 2DNZ
  • PDBsum: 2CQ4 2DNZ
  • STRING: ENSP00000352956
• Other Databases: GeneCards:  RBM23  Malacards:  RBM23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0048024	regulation of mRNA splicing, via spliceosome	IDA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq