• Gene id: 55146

Gene Summary

• Gene Symbol: ZDHHC4   Gene   UCSC   Ensembl
• Aliases: ZNF374
• Gene name: zinc finger DHHC-type palmitoyltransferase 4
• Alternate names: probable palmitoyltransferase ZDHHC4, DHHC-4, zinc finger DHHC domain-containing protein 4, zinc finger DHHC-type containing 4, zinc finger protein 374, zinc finger, DHHC domain containing 4,
• Gene location: 7p22.1 (6577412: 6589373)     Exons: 10     NC_000007.14
• OMIM: 602225

Protein Summary

• Protein general information: Q9NPG8  
  • Name: Probable palmitoyltransferase ZDHHC4 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 4) (DHHC 4) (Zinc finger protein 374)
  • Length: 344  
  • Mass: 39787
• Sequence:

  MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIVLHLVL
  QGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEFDEVMFPKNVR
  CSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAIVSTTFLVHLVVMSDL
  YQETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYLAATNQTTNEWYRGDWAWCQR
  CPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE

• Structural information:
  • Protein Domains: (149..19-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000379934
• Other Databases: GeneCards:  ZDHHC4  Malacards:  ZDHHC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881