• Gene id: 5514

Gene Summary

• Gene Symbol: PPP1R10   Gene   UCSC   Ensembl
• Aliases: CAT53, FB19, PNUTS, PP1R10, R111, p99
• Gene name: protein phosphatase 1 regulatory subunit 10
• Alternate names: serine/threonine-protein phosphatase 1 regulatory subunit 10, HLA-C associated transcript 53, MHC class I region proline-rich protein CAT53, PP1-binding protein of 114 kDa, phosphatase 1 nuclear targeting subunit, protein phosphatase 1, regulatory (inhibitor) ,
• Gene location: 6p21.33 (30618606: 30600399)     Exons: 22     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein phosphatase 1 binding protein. The encoded protein plays a role in many cellular processes including cell cycle progression, DNA repair and apoptosis by regulating the activity of protein phosphatase 1. This gene lies within th
• OMIM: 614145

Protein Summary

• Protein general information: Q96QC0  
  • Name: Serine/threonine protein phosphatase 1 regulatory subunit 10 (MHC class I region proline rich protein CAT53) (PP1 binding protein of 114 kDa) (Phosphatase 1 nuclear targeting subunit) (Protein FB19) (p99)
  • Length: 940  
  • Mass: 99058
  • Tissue specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLL
  NNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDWMAVIRSQSST
  QPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKK
  NASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPV
  PGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDADRPGTPVPPVEVPELMDTASLEPGAL
  DAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRL
  SHDNMEEKVPWVCPRPLVLPSPLVTPGSNSQERYIQAEREKGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEE
  CSMDETPYVETLEPGGSGGSPDGAGGSKLPPVLANLMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEEL
  LKQPDYSDKIKQMLVPHGLLGPGPIANGFPPGGPGGPKGMQHFPPGPGGPMPGPHGGPGGPVGPRLLGPPPPPRG
  GDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPPPPFRGARGGRSGGGPPNGRGGPGGGMVGGGG
  HRPHEGPGGGMGNSSGHRPHEGPGGGMGSGHRPHEGPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGA
  GGGHRPHEGPGGSMGGSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGH
  SHGGDMSNRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP

• Structural information:
  • Protein Domains: (73..14-)
    (/note="TFIIS-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00649"-)
  • Interpro: IPR003617  IPR035441  IPR017923  IPR000571  IPR036855  
  • Prosite: PS51319 PS50103
  • DIP: 39343
  • STRING: ENSP00000365694
• Other Databases: GeneCards:  PPP1R10  Malacards:  PPP1R10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072357	PTW/PP1 phosphatase complex	ISS	cellular component
GO:0000785	chromatin	ISS	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006606	protein import into nucleus	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000785	chromatin	IEA	cellular component
GO:0072357	PTW/PP1 phosphatase complex	IEA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0010667	negative regulation of cardiac muscle cell apoptotic process	IDA	biological process
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:1904290	negative regulation of mitotic DNA damage checkpoint	IGI	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881