• Gene id: 55128

Gene Summary

• Gene Symbol: TRIM68   Gene   UCSC   Ensembl
• Aliases: GC109, RNF137, SS-56, SS56
• Gene name: tripartite motif containing 68
• Alternate names: E3 ubiquitin-protein ligase TRIM68, RING-type E3 ubiquitin transferase TRIM68, Ro/SSA1 related protein, SSA protein SS-56, ring finger protein 137, tripartite motif-containing protein 68,
• Gene location: 11p15.4 (4608230: 4598671)     Exons: 7     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the tripartite motif-containing protein family, whose members are characterized by a "really interesting new gene" (RING) finger domain, a zinc-binding B-box motif, and a coiled-coil region. Members of this family function as
• OMIM: 613184

Protein Summary

• Protein general information: Q6AZZ1  
  • Name: E3 ubiquitin protein ligase TRIM68 (EC 2.3.2.27) (RING finger protein 137) (RING type E3 ubiquitin transferase TRIM68) (SSA protein SS 56) (SS 56) (Tripartite motif containing protein 68)
  • Length: 485  
  • Mass: 56259
  • Tissue specificity: Widely expressed. Expressed at high levels in prostate cancer cell lines. Up-regulation could be restricted to androgen-dependent cells. {ECO
• Sequence:

  MDPTALVEAIVEEVACPICMTFLREPMSIDCGHSFCHSCLSGLWEIPGESQNWGYTCPLCRAPVQPRNLRPNWQL
  ANVVEKVRLLRLHPGMGLKGDLCERHGEKLKMFCKEDVLIMCEACSQSPEHEAHSVVPMEDVAWEYKWELHEALE
  HLKKEQEEAWKLEVGERKRTATWKIQVETRKQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQ
  KLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEPISLELKTDCRVLGLREILKT
  YAADVRLDPDTAYSRLIVSEDRKRVHYGDTNQKLPDNPERFYRYNIVLGSQCISSGRHYWEVEVGDRSEWGLGVC
  KQNVDRKEVVYLSPHYGFWVIRLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGSHIFTFP
  RYPFPGRLLPYFSPCYSIGTNNTAPLAICSLDGED

• Structural information:
  • Protein Domains: (285..48-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR042656  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021 cd16610
  • STRING: ENSP00000300747
• Other Databases: GeneCards:  TRIM68  Malacards:  TRIM68

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0045087	innate immune response	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray