• Gene id: 55122

Gene Summary

• Gene Symbol: AKIRIN2   Gene   UCSC   Ensembl
• Aliases: C6orf166, FBI1, dJ486L4.2
• Gene name: akirin 2
• Alternate names: akirin-2, fourteen-three-three beta interactant 1,
• Gene location: 6q15 (87702232: 87674859)     Exons: 5     NC_000006.12
• OMIM: 617815

Protein Summary

• Protein general information: Q53H80  
  • Name: Akirin 2
  • Length: 203  
  • Mass: 22496
  • Tissue specificity: Widely expressed with the highest expression in peripheral blood leukocytes. {ECO
• Sequence:

  MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSR
  LTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGM
  ICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS

• Structural information:
  • Interpro: IPR024132  
  • STRING: ENSP00000257787
• Other Databases: GeneCards:  AKIRIN2  Malacards:  AKIRIN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0010950	positive regulation of endopeptidase activity	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0009792	embryo development ending in birth or egg hatching	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0017053	transcription repressor complex	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881