• Gene id: 55117

Gene Summary

• Gene Symbol: SLC6A15   Gene   UCSC   Ensembl
• Aliases: NTT73, SBAT1, V7-3, hv7-3
• Gene name: solute carrier family 6 member 15
• Alternate names: sodium-dependent neutral amino acid transporter B(0)AT2, homolog of rat orphan transporter v7-3, orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, sodium- and chloride-dependent neurotransmitter transporter NTT,
• Gene location: 12q21.31 (84912828: 84859490)     Exons: 13     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the solute carrier family 6 protein family which transports neutral amino acids. The encoded protein is thought to play a role in neuronal amino acid transport (PMID: 16185194) and may be associated with major depression (PMI
• OMIM: 607971

Protein Summary

• Protein general information: Q9H2J7  
  • Name: Sodium dependent neutral amino acid transporter B(0)AT2 (Sodium and chloride dependent neurotransmitter transporter NTT73) (Sodium coupled branched chain amino acid transporter 1) (Solute carrier family 6 member 15) (Transporter v7 3)
  • Length: 730  
  • Mass: 81836
  • Tissue specificity: Almost exclusively expressed in the brain. {ECO
• Sequence:

  MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQYILAQV
  GFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMVIGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCVV
  CYFVALYYNVIIGWSLFYFSQSFQQPLPWDQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLN
  WKMTICLLAAWVMVCLAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPKLEIMLEPKVWR
  EAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKANVINEKCITQNSETI
  MKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPALHLNSCKIEEELNKAVQGTGLAFIAFTEAM
  THFPASPFWSVMFFLMLVNLGLGSMFGTIEGIVTPIVDTFKVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFD
  DYSATLPLLIVVILENIAVCFVYGIDKFMEDLKDMLGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYN
  AWIEDKASEEFLSYPTWGLVVCVSLVVFAILPVPVVFIVRRFNLIDDSSGNLASVTYKRGRVLKEPVNLEGDDTS
  LIHGKIPSEMPSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMADIMPDMPESDL

• Structural information:
  • Interpro: IPR042934  IPR000175  IPR002438  IPR037272  
  • Prosite: PS00610 PS00754 PS50267
  • CDD: cd11522
  • STRING: ENSP00000266682
• Other Databases: GeneCards:  SLC6A15  Malacards:  SLC6A15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005298	proline:sodium symporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0015820	leucine transport	IBA	biological process
GO:0015804	neutral amino acid transport	IDA	biological process
GO:0015820	leucine transport	ISS	biological process
GO:0015824	proline transport	ISS	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015824	proline transport	IEA	biological process
GO:0005298	proline:sodium symporter activity	IEA	molecular function
GO:0015820	leucine transport	IEA	biological process
GO:0015804	neutral amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:1903825	organic acid transmembrane transport	IEA	biological process
GO:1903825	organic acid transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0003333	amino acid transmembrane transport	IEA	biological process
GO:0003333	amino acid transmembrane transport	IEA	biological process
GO:0003333	amino acid transmembrane transport	IEA	biological process
GO:0005326	neurotransmitter transmembrane transporter activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0006836	neurotransmitter transport	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881