• Gene id: 55113

Gene Summary

• Gene Symbol: XKR8   Gene   UCSC   Ensembl
• Aliases: XRG8, hXkr8
• Gene name: XK related 8
• Alternate names: XK-related protein 8, X Kell blood group precursor-related family, member 8, X-linked Kx blood group related 8, XK, Kell blood group complex subunit-related family, member 8,
• Gene location: 1p35.3 (27959556: 27968092)     Exons: 5     NC_000001.11
• OMIM: 141800

Protein Summary

• Protein general information: Q9H6D3  
  • Name: XK related protein 8 (hXkr8) [Cleaved into: XK related protein 8, processed form]
  • Length: 395  
  • Mass: 44655
• Sequence:

  MPWSSRGALLRDLVLGVLGTAAFLLDLGTDLWAAVQYALGGRYLWAALVLALLGLASVALQLFSWLWLRADPAGL
  HGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFLETAPQLTLVL
  AIMLQSGRAEYYQWVGICTSFLGISWALLDYHRALRTCLPSKPLLGLGSSVIYFLWNLLLLWPRVLAVALFSALF
  PSYVALHFLGLWLVLLLWVWLQGTDFMPDPSSEWLYRVTVATILYFSWFNVAEGRTRGRAIIHFAFLLSDSILLV
  ATWVTHSSWLPSGIPLQLWLPVGCGCFFLGLALRLVYYHWLHPSCCWKPDPDQVDGARSLLSPEGYQLPQNRRMT
  HLAQKFFPKAKDEAASPVKG

• Structural information:
  • Interpro: IPR018629  
  • STRING: ENSP00000362991
• Other Databases: GeneCards:  XKR8  Malacards:  XKR8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043652	engulfment of apoptotic cell	IBA	biological process
GO:0070782	phosphatidylserine exposure on apoptotic cell surface	IBA	biological process
GO:1902742	apoptotic process involved in development	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0070782	phosphatidylserine exposure on apoptotic cell surface	IDA	biological process
GO:0043652	engulfment of apoptotic cell	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0070782	phosphatidylserine exposure on apoptotic cell surface	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male sterility	MIK: 31712393

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31712393	Male sterility				Male infertility