• Gene id: 55103

Gene Summary

• Gene Symbol: RALGPS2   Gene   UCSC   Ensembl
• Aliases: dJ595C2.1
• Gene name: Ral GEF with PH domain and SH3 binding motif 2
• Alternate names: ras-specific guanine nucleotide-releasing factor RalGPS2, Ral-A exchange factor RalGPS2, ral GEF with PH domain and SH3-binding motif 2, ralA exchange factor RalGPS2,
• Gene location: 1q25.2 (178725146: 178921841)     Exons: 21     NC_000001.11
• OMIM: 617819

Protein Summary

• Protein general information: Q86X27  
  • Name: Ras specific guanine nucleotide releasing factor RalGPS2 (Ral GEF with PH domain and SH3 binding motif 2) (RalA exchange factor RalGPS2)
  • Length: 583  
  • Mass: 65167
• Sequence:

  MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQPDELSS
  CGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSA
  PIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILEN
  EQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGTSTPRSAASREDL
  VGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSV
  MEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFERNRLYHSLGPVTRVARNGYRSHMKASSSAESEDLA
  VHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVIGWMVM
  MADDPEHPDLFLLTDSEKGNSYKFQAGNRMNAMLWFKHLSAACQSNKQQVPTNLMTFE

• Structural information:
  • Protein Domains: (49..28-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168-)
    (457..56-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR011993  IPR001849  IPR030708  IPR008937  IPR023578   IPR001895  IPR036964  
  • Prosite: PS50003 PS50009
  • CDD: cd00155
  • STRING: ENSP00000356607
• Other Databases: GeneCards:  RALGPS2  Malacards:  RALGPS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032485	regulation of Ral protein signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881