• Gene id: 5510

Gene Summary

• Gene Symbol: PPP1R7   Gene   UCSC   Ensembl
• Aliases: SDS22
• Gene name: protein phosphatase 1 regulatory subunit 7
• Alternate names: protein phosphatase 1 regulatory subunit 7, protein phosphatase 1 regulatory subunit 22, protein phosphatase 1, regulatory (inhibitor) subunit 7, testis secretory sperm-binding protein Li 210a,
• Gene location: 2q37.3 (241149572: 241183651)     Exons: 13     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores
• OMIM: 602877

Protein Summary

• Protein general information: Q15435  
  • Name: Protein phosphatase 1 regulatory subunit 7 (Protein phosphatase 1 regulatory subunit 22)
  • Length: 360  
  • Mass: 41564
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLD
  RDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS
  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQN
  LDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
  FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF

• Structural information:
  • Protein Domains: (331..36-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR003591  IPR032675  IPR003603  
  • Prosite: PS51450
  • PDB: 6HKW 6MKY 6OBN 6OBP
  • PDBsum: 6HKW 6MKY 6OBN 6OBP
  • DIP: 1005
  • STRING: ENSP00000234038
• Other Databases: GeneCards:  PPP1R7  Malacards:  PPP1R7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005694	chromosome	IDA	cellular component
GO:0035307	positive regulation of protein dephosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0030234	enzyme regulator activity	NAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R