• Gene id: 55072

Gene Summary

• Gene Symbol: RNF31   Gene   UCSC   Ensembl
• Aliases: HOIP, Paul, ZIBRA
• Gene name: ring finger protein 31
• Alternate names: E3 ubiquitin-protein ligase RNF31, HOIL-1-interacting protein, RING-type E3 ubiquitin transferase RNF31, zinc in-between-RING-finger ubiquitin-associated domain protein,
• Gene location: 14q12 (24146874: 24160660)     Exons: 22     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. The encoded protein is the E3 ubiquitin-protein ligase compon
• OMIM: 610108

Protein Summary

• Protein general information: Q96EP0  
  • Name: E3 ubiquitin protein ligase RNF31 (EC 2.3.2.31) (HOIL 1 interacting protein) (HOIP) (RING finger protein 31) (RING type E3 ubiquitin transferase RNF31) (Zinc in between RING finger ubiquitin associated domain protein)
  • Length: 1072  
  • Mass: 119652
  • Tissue specificity: Expressed in both normal and transformed breast epithelial cell lines. {ECO
• Sequence:

  MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTA
  LNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVT
  LEVLLLRTELSLLLQNTHPRQQALEQLLEDKVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPG
  TLHCPSCKQALCPACDHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
  HLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCTFENEAAAVLCSICER
  PRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTFCNSSPGWVCVMCNRTSSPIPAQHAPRPYAS
  SLEKGPPKPGPPRRLSAPLPSSCGDPEKQRQDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLR
  SELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQ
  HGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYEL
  GDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRP
  DLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFC
  VRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
  CYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQK
  EVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQ
  ARLLQKLTEEVPLGQSIPRRRK

• Structural information:
  • Protein Domains: (71..14-)
    (/note="PUB-)
    (/evidence="ECO:0000255-)
    (564..61-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212"-)
  • Interpro: IPR002867  IPR036339  IPR018997  IPR026254  IPR032065   IPR041031  IPR040641  IPR015940  IPR001876  IPR036443  IPR013083  IPR017907  
  • Prosite: PS51873 PS50030 PS01358 PS50199 PS00518
  • PDB: 2CT7 4DBG 4JUY 4LJO 4LJP 4LJQ 4OWF 4OYJ 4OYK 4P09 4P0A 4P0B 5EDV 5LJN 5X0W 6GZY 6SC5 6SC6 6SC7 6SC8 6SC9
  • PDBsum: 2CT7 4DBG 4JUY 4LJO 4LJP 4LJQ 4OWF 4OYJ 4OYK 4P09 4P0A 4P0B 5EDV 5LJN 5X0W 6GZY 6SC5 6SC6 6SC7 6SC8 6SC9
  • DIP: 44034
  • STRING: ENSP00000315112
• Other Databases: GeneCards:  RNF31  Malacards:  RNF31

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0097039	protein linear polyubiquitination	IDA	biological process
GO:1903955	positive regulation of protein targeting to mitochondrion	HMP	biological process
GO:0097039	protein linear polyubiquitination	IDA	biological process
GO:0097039	protein linear polyubiquitination	IDA	biological process
GO:0097039	protein linear polyubiquitination	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0071797	LUBAC complex	IDA	cellular component
GO:0071797	LUBAC complex	IDA	cellular component
GO:0071797	LUBAC complex	IDA	cellular component
GO:0071797	LUBAC complex	IDA	cellular component
GO:0071797	LUBAC complex	IDA	cellular component
GO:0071797	LUBAC complex	IDA	cellular component
GO:0050852	T cell receptor signaling pathway	IDA	biological process
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0071797	LUBAC complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009898	cytoplasmic side of plasma membrane	ISS	cellular component
GO:0023035	CD40 signaling pathway	ISS	biological process
GO:0035631	CD40 receptor complex	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04621	NOD-like receptor signaling pathway
hsa04217	Necroptosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq