• Gene id: 5507

Gene Summary

• Gene Symbol: PPP1R3C   Gene   UCSC   Ensembl
• Aliases: PPP1R5, PTG
• Gene name: protein phosphatase 1 regulatory subunit 3C
• Alternate names: protein phosphatase 1 regulatory subunit 3C, PP1 subunit R5, Phosphatase 1, regulatory inhibitor subunit 5, protein phosphatase 1 regulatory subunit 5, protein phosphatase 1, regulatory (inhibitor) subunit 3C, protein targeting to glycogen,
• Gene location: 10q23.32 (91633070: 91628441)     Exons: 2     NC_000010.11
• Gene summary(Entrez): This gene encodes a carbohydrate binding protein that is a subunit of the protein phosphatase 1 (PP1) complex. PP1 catalyzes reversible protein phosphorylation, which is important in a wide range of cellular activities. The encoded protein affects glycoge
• OMIM: 602999

Protein Summary

• Protein general information: Q9UQK1  
  • Name: Protein phosphatase 1 regulatory subunit 3C (Protein phosphatase 1 regulatory subunit 5) (PP1 subunit R5) (Protein targeting to glycogen) (PTG)
  • Length: 317  
  • Mass: 36445
• Sequence:

  MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWK
  CSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQPSTDYLSFRS
  HFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPV
  IPTEQKIEFCISYHANGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGL
  FPEWQSWGRMENLASYR

• Structural information:
  • Protein Domains: (149..25-)
    (/note="CBM21-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00491"-)
  • Interpro: IPR005036  IPR038175  IPR017434  IPR030683  
  • Prosite: PS51159
  • STRING: ENSP00000238994
• Other Databases: GeneCards:  PPP1R3C  Malacards:  PPP1R3C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001069	glycogen binding	IBA	molecular function
GO:0008157	protein phosphatase 1 binding	IBA	molecular function
GO:0005979	regulation of glycogen biosynthetic process	IBA	biological process
GO:0000164	protein phosphatase type 1 complex	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005978	glycogen biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0005978	glycogen biosynthetic process	IEA	biological process
GO:2001069	glycogen binding	IEA	molecular function
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005977	glycogen metabolic process	ISS	biological process
GO:0005978	glycogen biosynthetic process	ISS	biological process
GO:0019903	protein phosphatase binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway
hsa04931	Insulin resistance

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)