• Gene id: 55068

Gene Summary

• Gene Symbol: ENOX1   Gene   UCSC   Ensembl
• Aliases: CNOX, PIG38, bA64J21.1, cCNOX
• Gene name: ecto-NOX disulfide-thiol exchanger 1
• Alternate names: ecto-NOX disulfide-thiol exchanger 1, candidate growth-related and time keeping constitutive hydroquinone (NADH) oxidase, candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase, cell proliferation-inducing gene 38 protein, constitu,
• Gene location: 13q14.11 (16033712: 16042134)     Exons: 6     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is involved in plasma membrane electron transport pathways. The encoded protein has both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity. The two activities cycle with a periodicit
• OMIM: 610914

Protein Summary

• Protein general information: Q8TC92  
  • Name: Ecto NOX disulfide thiol exchanger 1 (Candidate growth related and time keeping constitutive hydroquinone [NADH] oxidase) (cCNOX) (Cell proliferation inducing gene 38 protein) (Constitutive Ecto NOX) (cNOX) [Includes: Hydroquinone [NADH] oxidase (EC 1. .
  • Length: 643  
  • Mass: 73348
  • Tissue specificity: Expressed in lymphocyte cells, breast and breast cancer (at protein level). Found in the sera of cancer patients with a wide variety of cancers including breast, prostate, lung and ovarian cancers, leukemias, and lymphomas. Found also
• Sequence:

  MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSDSICVP
  GFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPGCKTVFVGGLP
  ENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKDSGRLHVDFAQARDDF
  YEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFSEAITVLLSWIERGEVNRRSA
  NQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIVAVFNASTRQKAWDHFSKAQRKNIDI
  WRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDESALAAQAYALKEENDSLRWQLDAYRNEVELL
  KQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKEL
  VETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQGLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSK
  ISANEIEMLLMRLPRMFKQEFTGVGATLEKRWKLCAFEGIKTT

• Structural information:
  • Protein Domains: (142..22-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR038876  IPR034140  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12228
  • STRING: ENSP00000261488
• Other Databases: GeneCards:  ENOX1  Malacards:  ENOX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007624	ultradian rhythm	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray