• Gene id: 55065

Gene Summary

• Gene Symbol: SLC52A1   Gene   UCSC   Ensembl
• Aliases: GPCR42, GPR172B, PAR2, RBFVD, RFT1, RFVT1, hRFT1, huPAR-2
• Gene name: solute carrier family 52 member 1
• Alternate names: solute carrier family 52, riboflavin transporter, member 1, G protein-coupled receptor 172B, G-protein coupled receptor GPCR42, PERV-A receptor 2, porcine endogenous retrovirus A receptor 2, solute carrier family 52 (riboflavin transporter), member 1,
• Gene location: 17p13.2 (5035431: 5032601)     Exons: 5     NC_000017.11
• Gene summary(Entrez): Biological redox reactions require electron donors and acceptor. Vitamin B2 is the source for the flavin in flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN) which are common redox reagents. This gene encodes a member of the riboflavin (vi
• OMIM: 612487

Protein Summary

• Protein general information: Q9NWF4  
  • Name: Solute carrier family 52, riboflavin transporter, member 1 (Porcine endogenous retrovirus A receptor 2) (PERV A receptor 2) (huPAR 2) (Protein GPR172B) (Riboflavin transporter 1) (hRFT1)
  • Length: 448  
  • Mass: 46317
  • Tissue specificity: Widely expressed. Highly expressed in the testis, placenta and small intestine. Expressed at lower level in other tissues. {ECO
• Sequence:

  MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRQLAPGK
  GEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLG
  QGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVT
  TGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEAHQLFSAHGAFLLGLMAFTSAVTNGVLPSV
  QSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGV
  VLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP

• Structural information:
  • Interpro: IPR009357  
  • STRING: ENSP00000399979
• Other Databases: GeneCards:  SLC52A1  Malacards:  SLC52A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032218	riboflavin transport	IBA	biological process
GO:0032217	riboflavin transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0032218	riboflavin transport	IDA	biological process
GO:0032217	riboflavin transmembrane transporter activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0032218	riboflavin transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0032217	riboflavin transmembrane transporter activity	IEA	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006771	riboflavin metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq