• Gene id: 550643

Gene Summary

• Gene Symbol: NBDY   Gene   UCSC   Ensembl
• Aliases: LINC01420, NoBody
• Gene name: negative regulator of P-body association
• Alternate names: negative regulator of P-body association, P-body dissociating protein, long intergenic non-protein coding RNA 1420, non-annotated P-body dissociating polypeptide, protein NoBody,
• Gene location: Xp11.21 (56729241: 56819178)     Exons: 3     NC_000023.11
• OMIM: 300992

Protein Summary

• Protein general information: A0A0U1RRE5  
  • Name: Negative regulator of P body association (P body dissociating protein) (Protein NoBody)
  • Length: 68  
  • Mass: 7025
• Sequence:

  MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK

• Other Databases: GeneCards:  NBDY  Malacards:  NBDY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0000956	nuclear-transcribed mRNA catabolic process	IDA	biological process
GO:0010607	negative regulation of cytoplasmic mRNA processing body assembly	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq