• Gene id: 55061

Gene Summary

• Gene Symbol: SUSD4   Gene   UCSC   Ensembl
• Aliases: PRO222
• Gene name: sushi domain containing 4
• Alternate names: sushi domain-containing protein 4, YHGM196, testicular secretory protein Li 55,
• Gene location: 1q41 (223365270: 223220825)     Exons: 15     NC_000001.11
• OMIM: 615827

Protein Summary

• Protein general information: Q5VX71  
  • Name: Sushi domain containing protein 4
  • Length: 490  
  • Mass: 53778
  • Tissue specificity: Isoform 3 is the predominant isoform in all tissues except cortex, cerebellum, kidney, and breast. Isoform 1 is found primarily in the esophagus and the brain. {ECO
• Sequence:

  MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVF
  FEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEG
  FKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECL
  QNLIWSSSPPRCLALEVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV
  YCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRSSSSDPDFVVVDGVPVM
  LPSYDEAVSGGLSALGPGYMASVGQGCPLPVDDQSPPAYPGSGDTDTGPGESETCDSVSGSSELLQSLYSPPRCQ
  ESTHPASDNPDIIASTAEEVASTSPGIDIADEIPLMEEDP

• Structural information:
  • Protein Domains: (55..11-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (120..17-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (178..23-)
    (/note="Sushi-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302"-)
  • Interpro: IPR042985  IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • STRING: ENSP00000344219
• Other Databases: GeneCards:  SUSD4  Malacards:  SUSD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045959	negative regulation of complement activation, classical pathway	IBA	biological process
GO:0045957	negative regulation of complement activation, alternative pathway	IBA	biological process
GO:0030449	regulation of complement activation	IDA	biological process
GO:0030449	regulation of complement activation	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)