• Gene id: 55054

Gene Summary

• Gene Symbol: ATG16L1   Gene   UCSC   Ensembl
• Aliases: APG16L, ATG16A, ATG16L, IBD10, WDR30
• Gene name: autophagy related 16 like 1
• Alternate names: autophagy-related protein 16-1, APG16L beta, ATG16 autophagy related 16-like 1, WD repeat domain 30,
• Gene location: 2q37.1 (233251570: 233295673)     Exons: 19     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to infla

Protein Summary

• Protein general information: Q676U5  
  • Name: Autophagy related protein 16 1 (APG16 like 1)
  • Length: 607  
  • Mass: 68265
• Sequence:

  MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDG
  TWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRT
  KLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELA
  EAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
  HPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFD
  SAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGS
  SCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQT
  FSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCK
  AVLWAQY

• Structural information:
  • Interpro: IPR013923  IPR020472  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 4GDK 4GDL 4NAW 4TQ0 5D7G 5NPV 5NPW 5NUV 5ZYX
  • PDBsum: 4GDK 4GDL 4NAW 4TQ0 5D7G 5NPV 5NPW 5NUV 5ZYX
  • DIP: 27552 50290
  • STRING: ENSP00000375872
• Other Databases: GeneCards:  ATG16L1  Malacards:  ATG16L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0039689	negative stranded viral RNA replication	IBA	biological process
GO:0000421	autophagosome membrane	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:0005930	axoneme	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0019787	ubiquitin-like protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0034045	phagophore assembly site membrane	IEA	cellular component
GO:0051020	GTPase binding	IPI	molecular function
GO:0005776	autophagosome	ISS	cellular component
GO:0000045	autophagosome assembly	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04621	NOD-like receptor signaling pathway
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray