• Gene id: 55052

Gene Summary

• Gene Symbol: MRPL20   Gene   UCSC   Ensembl
• Aliases: L20mt, MRP-L20
• Gene name: mitochondrial ribosomal protein L20
• Alternate names: 39S ribosomal protein L20, mitochondrial, mitochondrial large ribosomal subunit protein bL20m,
• Gene location: 1p36.33 (1407292: 1401908)     Exons: 4     NC_000001.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611833

Protein Summary

• Protein general information: Q9BYC9  
  • Name: 39S ribosomal protein L20, mitochondrial (L20mt) (MRP L20) (Mitochondrial large ribosomal subunit protein bL20m)
  • Length: 149  
  • Mass: 17443
• Sequence:

  MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAA
  SQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

• Structural information:
  • Interpro: IPR005813  IPR035566  
  • CDD: cd07026
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000341082
• Other Databases: GeneCards:  MRPL20  Malacards:  MRPL20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0000027	ribosomal large subunit assembly	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005761	mitochondrial ribosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0019843	rRNA binding	IEA	molecular function
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881