• Gene id: 5504

Gene Summary

• Gene Symbol: PPP1R2   Gene   UCSC   Ensembl
• Aliases: IPP-2, IPP2, PPP1R2A
• Gene name: protein phosphatase 1 regulatory inhibitor subunit 2
• Alternate names: protein phosphatase inhibitor 2, phosphoprotein phosphatase,
• Gene location: 3q29 (195543347: 195514427)     Exons: 8     NC_000003.12
• Gene summary(Entrez): Protein phosphatase-1 (PP1) is one of the main eukaryotic serine/threonine phosphatases. The protein encoded by this gene binds to the catalytic subunit of PP1, strongly inhibiting its activity. Ten related pseudogenes have been found throughout the human
• OMIM: 601792

Protein Summary

• Protein general information: P41236  
  • Name: Protein phosphatase inhibitor 2 (IPP 2)
  • Length: 205  
  • Mass: 23015
• Sequence:

  MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPY
  HSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQFEMKRKLHYNE
  GLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS

• Structural information:
  • Interpro: IPR007062  
  • DIP: 781
  • STRING: ENSP00000484580
• Other Databases: GeneCards:  PPP1R2  Malacards:  PPP1R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043666	regulation of phosphoprotein phosphatase activity	IBA	biological process
GO:0004864	protein phosphatase inhibitor activity	IBA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0004865	protein serine/threonine phosphatase inhibitor activity	TAS	molecular function
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R