• Gene id: 55038

Gene Summary

• Gene Symbol: CDCA4   Gene   UCSC   Ensembl
• Aliases: HEPP, SEI-3/HEPP
• Gene name: cell division cycle associated 4
• Alternate names: cell division cycle-associated protein 4, hematopoietic progenitor protein,
• Gene location: 14q32.33 (105021082: 105009572)     Exons: 2     NC_000014.9
• Gene summary(Entrez): This gene encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the re
• OMIM: 612270

Protein Summary

• Protein general information: Q9BXL8  
  • Name: Cell division cycle associated protein 4 (Hematopoietic progenitor protein)
  • Length: 241  
  • Mass: 26114
  • Tissue specificity: Highest levels of expression in the pancreas, thymus, testis, spleen, liver, placenta and leukocytes. Relatively low levels in the lung, kidney, prostate, ovary, small intestine and colon. Hardly detectable, if at all, in the brain, sk
• Sequence:

  MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQ
  DGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRHLQSSAWEMDG
  PRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCK
  SDLGELDHVVEILVET

• Structural information:
  • Protein Domains: (30..7-)
    (/note="SERTA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00396"-)
  • Interpro: IPR009263  
  • Prosite: PS51053
  • STRING: ENSP00000337226
• Other Databases: GeneCards:  CDCA4  Malacards:  CDCA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048096	chromatin-mediated maintenance of transcription	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray