• Gene id: 55034

Gene Summary

• Gene Symbol: MOCOS   Gene   UCSC   Ensembl
• Aliases: HMCS, MCS, MOS
• Gene name: molybdenum cofactor sulfurase
• Alternate names: molybdenum cofactor sulfurase,
• Gene location: 18q12.2 (87936574: 87881548)     Exons: 11     NC_000016.10
• Gene summary(Entrez): This gene encodes an enzyme that sulfurates the molybdenum cofactor which is required for activation of the xanthine dehydrogenase (XDH) and aldehyde oxidase (AO) enzymes. XDH catalyzes the conversion of hypoxanthine to uric acid via xanthine, as well as
• OMIM: 613274

Protein Summary

• Protein general information: Q96EN8  
  • Name: Molybdenum cofactor sulfurase (MCS) (MOS) (MoCo sulfurase) (hMCS) (EC 2.8.1.9) (Molybdenum cofactor sulfurtransferase)
  • Length: 888  
  • Mass: 98120
• Sequence:

  MAGAAAESGRELWTFAGSRDPSAPRLAYGYGPGSLRELRAREFSRLAGTVYLDHAGATLFSQSQLESFTSDLMEN
  TYGNPHSQNISSKLTHDTVEQVRYRILAHFHTTAEDYTVIFTAGSTAALKLVAEAFPWVSQGPESSGSRFCYLTD
  SHTSVVGMRNVTMAINVISTPVRPEDLWSAEERSASASNPDCQLPHLFCYPAQSNFSGVRYPLSWIEEVKSGRLH
  PVSTPGKWFVLLDAASYVSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLA
  GEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVALSSLQYPNGAPVVRIY
  SDSEFSSPEVQGPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRTGCFCNTGACQRHLGISNEMVRKHFQAGHVC
  GDNMDLIDGQPTGSVRISFGYMSTLDDVQAFLRFIIDTRLHSSGDWPVPQAHADTGETGAPSADSQADVIPAVMG
  RRSLSPQEDALTGSRVWNNSSTVNAVPVAPPVCDVARTQPTPSEKAAGVLEGALGPHVVTNLYLYPIKSCAAFEV
  TRWPVGNQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEVPLEENSERTQIRQSR
  VCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKKHGKDQLPGTMATLSLVNEAQYLLINTSSILEL
  HRQLNTSDENGKEELFSLKDLSLRFRANIIINGKRAFEEEKWDEISIGSLRFQVLGPCHRCQMICIDQQTGQRNQ
  HVFQKLSESRETKVNFGMYLMHASLDLSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS

• Structural information:
  • Protein Domains: (706..86-)
    (/note="MOSC-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03050"-)
  • Interpro: IPR000192  IPR005302  IPR028886  IPR005303  IPR015424   IPR015422  IPR015421  IPR011037  
  • Prosite: PS51340
  • STRING: ENSP00000261326
• Other Databases: GeneCards:  MOCOS  Malacards:  MOCOS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008265	Mo-molybdopterin cofactor sulfurase activity	IBA	molecular function
GO:0043545	molybdopterin cofactor metabolic process	IBA	biological process
GO:0008265	Mo-molybdopterin cofactor sulfurase activity	IEA	molecular function
GO:0030151	molybdenum ion binding	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006777	Mo-molybdopterin cofactor biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006777	Mo-molybdopterin cofactor biosynthetic process	IEA	biological process
GO:0102867	molybdenum cofactor sulfurtransferase activity	IEA	molecular function
GO:0008265	Mo-molybdopterin cofactor sulfurase activity	IEA	molecular function
GO:0032324	molybdopterin cofactor biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008265	Mo-molybdopterin cofactor sulfurase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0030151	molybdenum ion binding	IEA	molecular function
GO:0006777	Mo-molybdopterin cofactor biosynthetic process	IEA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0043545	molybdopterin cofactor metabolic process	IMP	biological process
GO:0008265	Mo-molybdopterin cofactor sulfurase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa00790	Folate biosynthesis

Diseases

Associated diseases	References
Xanthinuria	KEGG:H00192
Xanthinuria	KEGG:H00192
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)