• Gene id: 55032

Gene Summary

• Gene Symbol: SLC35A5   Gene   UCSC   Ensembl
• Gene name: solute carrier family 35 member A5
• Alternate names: probable UDP-sugar transporter protein SLC35A5,
• Gene location: 3q13.2 (32108042: 32176562)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene encodes a transmembrane protein which belongs to subfamily 35A of the solute carrier superfamily. The encoded protein is a nucleoside-sugar transporter. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]

Protein Summary

• Protein general information: Q9BS91  
  • Name: Probable UDP sugar transporter protein SLC35A5 (Solute carrier family 35 member A5)
  • Length: 424  
  • Mass: 48500
• Sequence:

  MEKQCCSHPVICSLSTMYTFLLGAIFIALSSSRILLVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIK
  KDHQSRNLKYASWKEFSDFMKWSIPAFLYFLDNLIVFYVLSYLQPAMAVIFSNFSIITTALLFRIVLKRRLNWIQ
  WASLLTLFLSIVALTAGTKTLQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARVFS
  HIRLGMGHVLIIVQCFISSMANIYNEKILKEGNQLTESIFIQNSKLYFFGILFNGLTLGLQRSNRDQIKNCGFFY
  GHSAFSVALIFVTAFQGLSVAFILKFLDNMFHVLMAQVTTVIITTVSVLVFDFRPSLEFFLEAPSVLLSIFIYNA
  SKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF

• Structural information:
  • Interpro: IPR007271  
  • STRING: ENSP00000417654
• Other Databases: GeneCards:  SLC35A5  Malacards:  SLC35A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015165	pyrimidine nucleotide-sugar transmembrane transporter activity	IEA	molecular function
GO:0090481	pyrimidine nucleotide-sugar transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq