• Gene id: 55022

Gene Summary

• Gene Symbol: PID1   Gene   UCSC   Ensembl
• Aliases: HMFN2073, NYGGF4, P-CLI1, PCLI1
• Gene name: phosphotyrosine interaction domain containing 1
• Alternate names: PTB-containing, cubilin and LRP1-interacting protein, phosphotyrosine interaction domain-containing protein 1,
• Gene location: 2q36.3 (229271286: 229023972)     Exons: 7     NC_000002.12
• OMIM: 612930

Protein Summary

• Protein general information: Q7Z2X4  
  • Name: PTB containing, cubilin and LRP1 interacting protein (P CLI1) (Phosphotyrosine interaction domain containing protein 1) (Protein NYGGF4)
  • Length: 250  
  • Mass: 28272
  • Tissue specificity: Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte. {ECO
• Sequence:

  MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIE
  LCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDH
  KGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHS
  MKSDGRIHSNSSSEEVSQELESDDG

• Structural information:
  • Protein Domains: (93..25-)
    (/note="PID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148"-)
  • Interpro: IPR011993  IPR039112  IPR039114  IPR006020  
  • Prosite: PS01179
  • CDD: cd13167
  • STRING: ENSP00000375907
• Other Databases: GeneCards:  PID1  Malacards:  PID1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0046325	negative regulation of glucose import	IBA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IBA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001171	positive regulation of ATP biosynthetic process	IEA	biological process
GO:0071398	cellular response to fatty acid	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0071354	cellular response to interleukin-6	IEA	biological process
GO:0071345	cellular response to cytokine stimulus	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0046325	negative regulation of glucose import	IEA	biological process
GO:0044320	cellular response to leptin stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IDA	biological process
GO:0010635	regulation of mitochondrial fusion	IC	biological process
GO:0045444	fat cell differentiation	IDA	NOT|biological process
GO:0070346	positive regulation of fat cell proliferation	IDA	biological process
GO:1903077	negative regulation of protein localization to plasma membrane	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0006112	energy reserve metabolic process	IC	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0070584	mitochondrion morphogenesis	IMP	biological process
GO:0071356	cellular response to tumor necrosis factor	ISS	biological process
GO:0071356	cellular response to tumor necrosis factor	NAS	biological process
GO:0071398	cellular response to fatty acid	ISS	biological process
GO:2001170	negative regulation of ATP biosynthetic process	IMP	biological process
GO:0046325	negative regulation of glucose import	IDA	biological process
GO:2001171	positive regulation of ATP biosynthetic process	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0051881	regulation of mitochondrial membrane potential	ISS	biological process
GO:0051881	regulation of mitochondrial membrane potential	TAS	biological process
GO:0071345	cellular response to cytokine stimulus	ISS	biological process
GO:0071354	cellular response to interleukin-6	ISS	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	ISS	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881