• Gene id: 5502

Gene Summary

• Gene Symbol: PPP1R1A   Gene   UCSC   Ensembl
• Aliases: I1, IPP1
• Gene name: protein phosphatase 1 regulatory inhibitor subunit 1A
• Alternate names: protein phosphatase 1 regulatory subunit 1A, I-1, IPP-1, inhibitor-1, protein phosphatase inhibitor-1,
• Gene location: 12q13.2 (54588658: 54579245)     Exons: 7     NC_000012.12
• OMIM: 613246

Protein Summary

• Protein general information: Q13522  
  • Name: Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I 1) (IPP 1)
  • Length: 171  
  • Mass: 19011
• Sequence:

  MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQRKKMT
  RITPTMKELQMMVEHHLGQQQQGEEPEGAAESTETQESRPPGIPDTEVESRLGTSGTAKKTAECIPKTHERGSKE
  PSTKEPSTHIPPLDSKGANSV

• Structural information:
  • Interpro: IPR008466  
  • STRING: ENSP00000257905
• Other Databases: GeneCards:  PPP1R1A  Malacards:  PPP1R1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0004865	protein serine/threonine phosphatase inhibitor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04720	Long-term potentiation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq