• Gene id: 55009

Gene Summary

• Gene Symbol: FAM174C   Gene   UCSC   Ensembl
• Aliases: C19orf24
• Gene name: family with sequence similarity 174 member C
• Alternate names: protein FAM174C,
• Gene location: 19p13.3 (1275529: 1279227)     Exons: 3     NC_000019.10

Protein Summary

• Protein general information: Q9BVV8  
  • Name: Protein FAM174C
  • Length: 132  
  • Mass: 14249
• Sequence:

  MGPRVLQPPLLLLLLALLLAALPCGAEEASPLRPAQVTLSPPPAVTNGSQPGAPHNSTHTRPPGASGSALTRSFY
  VILGFCGLTALYFLIRAFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNLR

• Structural information:
  • Interpro: IPR009565  
  • STRING: ENSP00000386557
• Other Databases: GeneCards:  FAM174C  Malacards:  FAM174C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005576	extracellular region	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq