Search Result
Gene id | 55005 | ||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
Gene Symbol | RMND1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
Aliases | C6orf96, COXPD11, RMD1, bA351K16, bA351K16.3 | ||||||||||||||||||||||||||||||||||||
Gene name | required for meiotic nuclear division 1 homolog | ||||||||||||||||||||||||||||||||||||
Alternate names | required for meiotic nuclear division protein 1 homolog, | ||||||||||||||||||||||||||||||||||||
Gene location |
6q25.1 (151452180: 151404547) Exons: 14 NC_000006.12 |
||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The protein encoded by this gene belongs to the evolutionary conserved sif2 family of proteins that share the DUF155 domain in common. This protein is thought to be localized in the mitochondria and involved in mitochondrial translation. Mutations in this |
||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
Protein general information | Q9NWS8 Name: Required for meiotic nuclear division protein 1 homolog Length: 449 Mass: 51604 | ||||||||||||||||||||||||||||||||||||
Sequence |
MPATLLRAVARSHHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTASGLNKSQILEMNQKKS DTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKA SRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQDLASHGYVEVTSLPRDAANILVMGVENSAKEGDPGT IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL EKFAFSNALCLSVKLAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDF YWDRENLEGLYDKTCQFLSIGRRVKVMNEKLQHCMELTDLMRNHLNEKRALRLEWMIVILITIEVMFELGRVFF | ||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: RMND1 Malacards: RMND1 | ||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
|