• Gene id: 55005

Gene Summary

• Gene Symbol: RMND1   Gene   UCSC   Ensembl
• Aliases: C6orf96, COXPD11, RMD1, bA351K16, bA351K16.3
• Gene name: required for meiotic nuclear division 1 homolog
• Alternate names: required for meiotic nuclear division protein 1 homolog,
• Gene location: 6q25.1 (151452180: 151404547)     Exons: 14     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the evolutionary conserved sif2 family of proteins that share the DUF155 domain in common. This protein is thought to be localized in the mitochondria and involved in mitochondrial translation. Mutations in this

Protein Summary

• Protein general information: Q9NWS8  
  • Name: Required for meiotic nuclear division protein 1 homolog
  • Length: 449  
  • Mass: 51604
• Sequence:

  MPATLLRAVARSHHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTASGLNKSQILEMNQKKS
  DTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKA
  SRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQDLASHGYVEVTSLPRDAANILVMGVENSAKEGDPGT
  IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL
  EKFAFSNALCLSVKLAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDF
  YWDRENLEGLYDKTCQFLSIGRRVKVMNEKLQHCMELTDLMRNHLNEKRALRLEWMIVILITIEVMFELGRVFF

• Structural information:
  • Interpro: IPR003734  
  • STRING: ENSP00000356272
• Other Databases: GeneCards:  RMND1  Malacards:  RMND1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070131	positive regulation of mitochondrial translation	IBA	biological process
GO:0070131	positive regulation of mitochondrial translation	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Combined oxidative phosphorylation deficiency	KEGG:H00891
Combined oxidative phosphorylation deficiency	KEGG:H00891
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881