• Gene id: 55004

Gene Summary

• Gene Symbol: LAMTOR1   Gene   UCSC   Ensembl
• Aliases: C11orf59, PDRO, Ragulator1, p18, p27RF-Rho
• Gene name: late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
• Alternate names: ragulator complex protein LAMTOR1, RhoA activator C11orf59, late endosomal/lysosomal adaptor and MAPK and MTOR activator 1, lipid raft adaptor protein p18, p27Kip1-releasing factor from RhoA, p27kip1 releasing factor from RhoA, protein associated with DRMs and ,
• Gene location: 11q13.4 (72103296: 72097291)     Exons: 5     NC_000011.10
• OMIM: 604237

Protein Summary

• Protein general information: Q6IAA8  
  • Name: Ragulator complex protein LAMTOR1 (Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1) (Lipid raft adaptor protein p18) (Protein associated with DRMs and endosomes) (p27Kip1 releasing factor from RhoA) (p27RF Rho)
  • Length: 161  
  • Mass: 17745
• Sequence:

  MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQG
  MEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDA
  KEELVVQFGIP

• Structural information:
  • Interpro: IPR028209  
  • PDB: 5X6U 5X6V 5Y39 5Y3A 6B9X 6EHP 6EHR 6NZD 6U62 6ULG
  • PDBsum: 5X6U 5X6V 5Y39 5Y3A 6B9X 6EHP 6EHR 6NZD 6U62 6ULG
  • DIP: 39650
  • STRING: ENSP00000278671
• Other Databases: GeneCards:  LAMTOR1  Malacards:  LAMTOR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:0071986	Ragulator complex	IBA	cellular component
GO:0001919	regulation of receptor recycling	IBA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IBA	contributes to
GO:0034613	cellular protein localization	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0060090	molecular adaptor activity	IBA	contributes to
GO:0071986	Ragulator complex	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0060090	molecular adaptor activity	IDA	contributes to
GO:0005085	guanyl-nucleotide exchange factor activity	IDA	contributes to
GO:0071230	cellular response to amino acid stimulus	IMP	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0042632	cholesterol homeostasis	IMP	biological process
GO:0032418	lysosome localization	ISS	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0031902	late endosome membrane	ISS	cellular component
GO:0001558	regulation of cell growth	IMP	biological process
GO:0010872	regulation of cholesterol esterification	IMP	biological process
GO:0007040	lysosome organization	ISS	biological process
GO:0007032	endosome organization	ISS	biological process
GO:0060620	regulation of cholesterol import	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0034613	cellular protein localization	IMP	biological process
GO:0016197	endosomal transport	ISS	biological process
GO:0010874	regulation of cholesterol efflux	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001919	regulation of receptor recycling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007040	lysosome organization	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0032008	positive regulation of TOR signaling	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0071986	Ragulator complex	IEA	cellular component
GO:0001919	regulation of receptor recycling	IEA	biological process
GO:0016197	endosomal transport	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0032418	lysosome localization	IEA	biological process
GO:0007040	lysosome organization	IEA	biological process
GO:0007032	endosome organization	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0016197	endosomal transport	IEA	biological process
GO:0001919	regulation of receptor recycling	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0051020	GTPase binding	IPI	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:0071986	Ragulator complex	IBA	cellular component
GO:0001919	regulation of receptor recycling	IBA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IBA	contributes to
GO:0034613	cellular protein localization	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0060090	molecular adaptor activity	IBA	contributes to
GO:0071986	Ragulator complex	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0060090	molecular adaptor activity	IDA	contributes to
GO:0005085	guanyl-nucleotide exchange factor activity	IDA	contributes to
GO:0071230	cellular response to amino acid stimulus	IMP	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0042632	cholesterol homeostasis	IMP	biological process
GO:0032418	lysosome localization	ISS	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0031902	late endosome membrane	ISS	cellular component
GO:0001558	regulation of cell growth	IMP	biological process
GO:0010872	regulation of cholesterol esterification	IMP	biological process
GO:0007040	lysosome organization	ISS	biological process
GO:0007032	endosome organization	ISS	biological process
GO:0060620	regulation of cholesterol import	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0034613	cellular protein localization	IMP	biological process
GO:0016197	endosomal transport	ISS	biological process
GO:0010874	regulation of cholesterol efflux	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001919	regulation of receptor recycling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007040	lysosome organization	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0032008	positive regulation of TOR signaling	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0071986	Ragulator complex	IEA	cellular component
GO:0001919	regulation of receptor recycling	IEA	biological process
GO:0016197	endosomal transport	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0032418	lysosome localization	IEA	biological process
GO:0007040	lysosome organization	IEA	biological process
GO:0007032	endosome organization	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0016197	endosomal transport	IEA	biological process
GO:0001919	regulation of receptor recycling	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0051020	GTPase binding	IPI	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881