• Gene id: 55003

Gene Summary

• Gene Symbol: PAK1IP1   Gene   UCSC   Ensembl
• Aliases: MAK11, PIP1, WDR84, bA421M1.5, hPIP1
• Gene name: PAK1 interacting protein 1
• Alternate names: p21-activated protein kinase-interacting protein 1, PAK/PLC-interacting protein 1, WD repeat-containing protein 84,
• Gene location: 6p24.2 (10690864: 10709781)     Exons: 12     NC_000006.12
• OMIM: 607811

Protein Summary

• Protein general information: Q9NWT1  
  • Name: p21 activated protein kinase interacting protein 1 (PAK/PLC interacting protein 1) (hPIP1) (PAK1 interacting protein 1) (WD repeat containing protein 84)
  • Length: 392  
  • Mass: 43964
  • Tissue specificity: Expressed in brain, colon, heart, kidney, liver, lung, muscle, peripheral blood leukocytes, placenta, small intestine, spleen and thymus. {ECO
• Sequence:

  MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSKDETIHIYDMKKKIEH
  GALVHHSGTITCLKFYGNRHLISGAEDGLICIWDAKKWECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTW
  NLVEGRSAFIKNIKQNAHIVEWSPRGEQYVVIIQNKIDIYQLDTASISGTITNEKRISSVKFLSESVLAVAGDEE
  VIRFFDCDSLVCLCEFKAHENRVKDMFSFEIPEHHVIVSASSDGFIKMWKLKQDKKVPPSLLCEINTNARLTCLG
  VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKESGLISTKKRKM
  VEMLEKKRKKKKIKTMQ

• Structural information:
  • Interpro: IPR020472  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000368887
• Other Databases: GeneCards:  PAK1IP1  Malacards:  PAK1IP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042273	ribosomal large subunit biogenesis	IMP	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	IMP	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0060021	roof of mouth development	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)