• Gene id: 5500

Gene Summary

• Gene Symbol: PPP1CB   Gene   UCSC   Ensembl
• Aliases: HEL-S-80p, MP, NSLH2, PP-1B, PP1B, PP1beta, PP1c, PPP1CD, PPP1beta
• Gene name: protein phosphatase 1 catalytic subunit beta
• Alternate names: serine/threonine-protein phosphatase PP1-beta catalytic subunit, epididymis secretory sperm binding protein Li 80p, myosin phosphatase, protein phosphatase 1, catalytic subunit, beta isoform, protein phosphatase 1, catalytic subunit, beta isozyme, protein phos,
• Gene location: 2p23.2 (4242252: 4189373)     Exons: 10     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division
• OMIM: 600590

Protein Summary

• Protein general information: P62140  
  • Name: Serine/threonine protein phosphatase PP1 beta catalytic subunit (PP 1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53)
  • Length: 327  
  • Mass: 37187
• Sequence:

  MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLF
  EYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKT
  FTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFT
  FGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
  KAKYQYGGLNSGRPVTPPRTANPPKKR

• Structural information:
  • Interpro: IPR004843  IPR029052  IPR006186  IPR031675  
  • Prosite: PS00125
  • DIP: 33220
  • STRING: ENSP00000378769
• Other Databases: GeneCards:  PPP1CB  Malacards:  PPP1CB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042752	regulation of circadian rhythm	IBA	biological process
GO:0032922	circadian regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0050115	myosin-light-chain-phosphatase activity	IDA	molecular function
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0072357	PTW/PP1 phosphatase complex	IDA	cellular component
GO:0072357	PTW/PP1 phosphatase complex	IDA	cellular component
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological process
GO:0006470	protein dephosphorylation	ISS	biological process
GO:0042752	regulation of circadian rhythm	IMP	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0016791	phosphatase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0050115	myosin-light-chain-phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000164	protein phosphatase type 1 complex	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005979	regulation of glycogen biosynthetic process	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0042587	glycogen granule	IEA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0043153	entrainment of circadian clock by photoperiod	IEA	biological process
GO:0005981	regulation of glycogen catabolic process	IEA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016791	phosphatase activity	IEA	molecular function
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0017018	myosin phosphatase activity	ISS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04810	Regulation of actin cytoskeleton
hsa04024	cAMP signaling pathway
hsa04510	Focal adhesion
hsa05034	Alcoholism
hsa05205	Proteoglycans in cancer
hsa04022	cGMP-PKG signaling pathway
hsa04390	Hippo signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04921	Oxytocin signaling pathway
hsa04910	Insulin signaling pathway
hsa04218	Cellular senescence
hsa04728	Dopaminergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04114	Oocyte meiosis
hsa04611	Platelet activation
hsa04931	Insulin resistance
hsa03015	mRNA surveillance pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction

Diseases

Associated diseases	References
Noonan syndrome and related disorders	KEGG:H00523
Noonan-like syndrome with loose anagen hair	KEGG:H02191
Noonan syndrome and related disorders	KEGG:H00523
Noonan-like syndrome with loose anagen hair	KEGG:H02191
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881