Male Infertility Database

Search Result

Gene id

Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

ACPP Gene UCSC Ensembl

Aliases

5'-NT, ACP-3, ACP3

Gene name

acid phosphatase, prostate

Alternate names

prostatic acid phosphatase, TMPase, ecto-5'-nucleotidase, prostatic acid phosphotase, thiamine monophosphatase,

Gene location

3q22.1 (132317366: 132368764) Exons: 12 NC_000003.12

Gene summary(Entrez)

This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced trans

OMIM

171790

SNPs

rs780798708

Strand:    Allele origin:   Allele change:   Mutation type: del

NC_000003.12   g.113380945_113380946del
NC_000003.11   g.113099792_113099793del
NM_018338.3   c.2005_2006del
NM_001164496.2   c.2005_2006del
NM_001164496.1   c.2005_2006del
NP_060808.2   p.Met669fs
NP_001157968.1   p.Met669fs|SEQ=[AT/-]|GENE=CFAP44

rs397515393

Strand:    Allele origin:   Allele change:   Mutation type: del

NC_000017.11   g.80039966del
NC_000017.10   g.78013765del
NG_029761.1   g.8335del
NM_017950.4   c.248del
NM_017950.3   c.248del
NM_001330508.2   c.248del
NM_001330508.1   c.248del
NM_001243342.1   c.248del
XM_011524963.3   c.158del
XM_011524965.3   c.248del
XR_934495.2

rs397515341

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000014.9   g.49633937_49633952dup
NC_000014.8   g.50100655_50100670dup
NG_013070.1   g.6280_6295dup
NM_018139.2   c.1199_1214dup
NM_001083908.1   c.1199_1214dup
NP_060609.2   p.Gly406fs
NP_001077377.1   p.Gly406fs|SEQ=[GCCACGCAGGTATCGTG/GCCACGCAGGTATCGTGCCACGCA

rs137853191

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000014.9   g.49635127G>A
NC_000014.9   g.49635127G>C
NC_000014.9   g.49635127G>T
NC_000014.8   g.50101845G>A
NC_000014.8   g.50101845G>C
NC_000014.8   g.50101845G>T
NG_013070.1   g.5104C>T
NG_013070.1   g.5104C>G
NG_013070.1   g.5104C>A
NM_018139.2   c.23C>T
NM_01813

rs76027725

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.50058101A>G
NC_000007.13   g.50097697A>G
NM_007009.3   c.375T>C
NM_007009.2   c.375T>C
XM_011515102.2   c.153T>C
XM_011515095.2   c.375T>C
XM_011515096.2   c.372T>C
XM_011515100.2   c.249T>C
XM_024446646.1   c.150T>C
XR_001744543.1   n.439T>C
XM_0115150

rs61696422

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.50093121C>G
NC_000007.14   g.50093121C>T
NC_000007.13   g.50132717C>G
NC_000007.13   g.50132717C>T
NM_007009.3   c.74G>C
NM_007009.3   c.74G>A
NM_007009.2   c.74G>C
NM_007009.2   c.74G>A
XM_011515101.3   c.74G>C
XM_011515101.3   c.74G>A
XM_011515102.2   c

rs17431717

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.120474407G>A
NC_000012.11   g.120912210G>A|SEQ=[G/A]|GENE=DYNLL1

rs16968382

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.76586021A>C
NC_000015.9   g.76878362A>C|SEQ=[A/C]|GENE=SCAPER
MIR3713   100500855

rs12625552

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.16427627A>G
NC_000020.10   g.16408272A>G
NG_028043.2   g.150808T>C
NG_028043.1   g.150808T>C|SEQ=[A/G]|GENE=KIF16B

rs11568732

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.94761817T>C
NC_000010.11   g.94761817T>G
NC_000010.10   g.96521574T>C
NC_000010.10   g.96521574T>G
NG_008384.3   g.4137T>C
NG_008384.3   g.4137T>G
NG_055436.1   g.1177T>C
NG_055436.1   g.1177T>G|SEQ=[T/C/G]|GENE=CYP2C19

rs10849753

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.120473010C>A
NC_000012.12   g.120473010C>T
NC_000012.11   g.120910813C>A
NC_000012.11   g.120910813C>T|SEQ=[C/A/T]|GENE=DYNLL1

rs4997052

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31356367T>A
NC_000006.12   g.31356367T>G
NC_000006.11   g.31324144T>A
NC_000006.11   g.31324144T>G
NG_023187.1   g.5846A>T
NG_023187.1   g.5846A>C
NM_005514.8   c.419A>T
NM_005514.8   c.419A>C
NM_005514.7   c.419A>T
NM_005514.7   c.419A>C
NM_005514.6   c.

rs4471514

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.95273561C>A
NC_000012.12   g.95273561C>T
NC_000012.11   g.95667337C>A
NC_000012.11   g.95667337C>T
NG_028987.2   g.60816C>A
NG_028987.2   g.60816C>T
NG_028987.1   g.60816C>A
NG_028987.1   g.60816C>T|SEQ=[C/A/T]|GENE=VEZT

rs3791185

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.107058247G>A
NC_000001.10   g.107600869G>A
NM_018137.2   c.*404G>A
NM_018137.3   c.*404G>A|SEQ=[G/A]|GENE=PRMT6

rs3749474

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000004.12   g.55434518C>T
NC_000004.11   g.56300685C>T
NM_004898.4   c.*897G>A
NM_004898.3   c.*897G>A
XM_011534409.2   c.*897G>A
XM_005265787.2   c.*897G>A
XM_005265787.1   c.*897G>A
XM_011534410.2   c.*897G>A
XM_011534411.2   c.*897G>A
NM_001267843.1   c.*897G>A
XM

rs3741843

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.10938833C>A
NC_000012.12   g.10938833C>G
NC_000012.12   g.10938833C>T
NC_000012.11   g.11091432C>A
NC_000012.11   g.11091432C>G
NC_000012.11   g.11091432C>T
NT_187658.1   g.137539C>A
NT_187658.1   g.137539C>G
NT_187658.1   g.137539C>T
NW_003571050.1   g

rs2287498

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.7689242C>T
NC_000017.10   g.7592560C>T
NG_017013.2   g.3309G>A
NG_028245.1   g.8172C>T
NM_018081.2   c.450C>T
NM_001143991.2   c.450C>T
NM_001143991.1   c.450C>T
NM_001143992.2   c.450C>T
NM_001143992.1   c.450C>T
NM_001143990.1   c.450C>T
XR_001752551.

rs2232015

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.107056636A>G
NC_000001.11   g.107056636A>T
NC_000001.10   g.107599258A>G
NC_000001.10   g.107599258A>T|SEQ=[A/G/T]|GENE=PRMT6

rs1801260

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000004.12   g.55435202A>G
NC_000004.11   g.56301369A>G
NM_004898.4   c.*213T>C
NM_004898.3   c.*213T>C
XM_011534409.2   c.*213T>C
XM_005265787.2   c.*213T>C
XM_005265787.1   c.*213T>C
XM_011534410.2   c.*213T>C
XM_011534411.2   c.*213T>C
NM_001267843.1   c.*213T>C
XM

rs1048055

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.1629416A>C
NC_000020.10   g.1610062A>C
NM_018556.4   c.*223T>G
NM_018556.3   c.*223T>G
XM_005260749.4   c.*223T>G
XM_005260749.1   c.*223T>G
XM_011529286.2   c.*223T>G
NM_080816.2   c.*223T>G
NM_080816.3   c.*223T>G
NM_001039508.1   c.*223T>G|SEQ=[A/C]|

rs1042389

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.41018248T>C
NC_000019.9   g.41524153T>C
NG_007929.1   g.31950T>C
NM_000767.5   c.*1421T>C
NM_000767.4   c.*1421T>C|SEQ=[T/C]|GENE=CYP2B6

rs1025689

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000003.12   g.53849695C>A
NC_000003.12   g.53849695C>G
NC_000003.12   g.53849695C>T
NC_000003.11   g.53883722C>A
NC_000003.11   g.53883722C>G
NC_000003.11   g.53883722C>T
NG_028042.1   g.1699G>T
NG_028042.1   g.1699G>C
NG_028042.1   g.1699G>A
XM_005265310.5   c.126C>

rs12676

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000003.12   g.53823776A>C
NC_000003.12   g.53823776A>T
NC_000003.11   g.53857803A>C
NC_000003.11   g.53857803A>T
NG_028042.1   g.27618T>G
NG_028042.1   g.27618T>A
NM_018397.5   c.233T>G
NM_018397.5   c.233T>A
NM_018397.4   c.233T>G
NM_018397.4   c.233T>A
XM_006713251

rs4986894

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.94762608T>C
NC_000010.10   g.96522365T>C
NG_008384.3   g.4928T>C
NG_055436.1   g.1968T>C|SEQ=[T/C]|GENE=CYP2C19

rs1801394

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.7870860A>G
NC_000005.9   g.7870973A>G
NG_008856.1   g.6757A>G
NM_024010.4   c.66A>G
NM_024010.3   c.66A>G
NM_024010.2   c.147A>G
NM_002454.3   c.66A>G
NM_002454.2   c.66A>G
NM_001364440.2   c.66A>G
NM_001364440.1   c.66A>G
NM_001364441.2   c.66A>G
NM_0013

rs161870

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.7878079T>C
NC_000005.10   g.7878079T>G
NC_000005.9   g.7878192T>C
NC_000005.9   g.7878192T>G
NG_008856.1   g.13976T>C
NG_008856.1   g.13976T>G
NM_024010.4   c.537T>C
NM_024010.4   c.537T>G
NM_024010.3   c.537T>C
NM_024010.3   c.537T>G
NM_024010.2   c.618T

rs162036

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.7885846A>G
NC_000005.9   g.7885959A>G
NG_008856.1   g.21743A>G
NM_024010.4   c.1049A>G
NM_024010.3   c.1049A>G
NM_024010.2   c.1130A>G
NM_002454.3   c.1049A>G
NM_002454.2   c.1049A>G
NM_001364440.2   c.1049A>G
NM_001364440.1   c.1049A>G
NM_001364441.2   c

rs1800682

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.88990206A>G
NC_000010.10   g.90749963A>G
NG_009089.2   g.4676A>G
NG_011541.1   g.6185T>C|SEQ=[A/G]|GENE=ACTA2
FAS   355

rs6811520

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000004.12   g.55449011T>C
NC_000004.11   g.56315178T>C|SEQ=[T/C]|GENE=CLOCK
TMEM165   55858

rs2281807

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.1629555C>T
NC_000020.10   g.1610201C>T
NM_018556.4   c.*84G>A
NM_018556.3   c.*84G>A
XM_005260749.4   c.*84G>A
XM_005260749.1   c.*84G>A
XM_011529286.2   c.*84G>A
NM_080816.2   c.*84G>A
NM_080816.3   c.*84G>A
NM_001039508.1   c.*84G>A|SEQ=[C/T]|GENE=SIR

rs779944215

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000001.11   g.167880125_167880126GT[1]
NC_000001.10   g.167849363_167849364GT[1]
NG_016139.1   g.39088_39089AC[1]
NM_018417.6   c.1203_1204AC[1]
NM_018417.5   c.1203_1204AC[1]
NM_018417.4   c.1203_1204AC[1]
NM_001167749.3   c.744_745AC[1]
NM_001167749.2   c.744_7

rs34605051

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.86466703T>C
NC_000002.11   g.86693826T>C
NG_047167.1   g.31057T>C
NM_018433.6   c.1339T>C
NM_018433.5   c.1339T>C
NM_001146688.1   c.1339T>C
XM_006712051.4   c.-637T>C
XM_024452995.1   c.1339T>C
XM_024452994.1   c.1339T>C
XM_017004494.1   c.484T>C
XM_02

Protein Summary

Protein general information

P15309

Name: Prostatic acid phosphatase (PAP) (EC 3.1.3.2) (5' nucleotidase) (5' NT) (EC 3.1.3.5) (Ecto 5' nucleotidase) (Thiamine monophosphatase) (TMPase) [Cleaved into: PAPf39]

Length: 386 Mass: 44,566

Sequence

MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGM
EQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSE
DQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPS
WATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL
DVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTT
NSHQGTEDSTD

Structural information

Interpro:	IPR033379 IPR000560 IPR029033
Prosite:	PS00616 PS00778
CDD:	cd07061
PDB:	1CVI 1ND5 1ND6 2HPA 2L3H 2L77 2L79 2MG0 3PPD
PDBsum:	1CVI 1ND5 1ND6 2HPA 2L3H 2L77 2L79 2MG0 3PPD
MINT:
STRING:	ENSP00000323036

Other Databases

GeneCards: ACPP Malacards: ACPP

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0003993	acid phosphatase activity	IMP	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006144	purine nucleobase metabol ic process	IEA	biological process
GO:0006772	thiamine metabolic proces s	ISS	biological process
GO:0008253	5'-nucleotidase activity	IDA	molecular function
GO:0009117	nucleotide metabolic proc ess	IEA	biological process
GO:0012506	vesicle membrane	ISS	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016311	dephosphorylation	IMP	biological process
GO:0016791	phosphatase activity	IMP	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0031985	Golgi cisterna	IEA	cellular component
GO:0033265	choline binding	IEA	molecular function
GO:0042131	thiamine phosphate phosph atase activity	ISS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0045177	apical part of cell	IEA	cellular component
GO:0046085	adenosine metabolic proce ss	IDA	biological process
GO:0051930	regulation of sensory per ception of pain	IMP	biological process
GO:0051930	regulation of sensory per ception of pain	IMP	biological process
GO:0052642	lysophosphatidic acid pho sphatase activity	IDA	molecular function
GO:0060168	positive regulation of ad enosine receptor signalin g pathway	IMP	biological process
GO:0060168	positive regulation of ad enosine receptor signalin g pathway	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0003993	acid phosphatase activity	IEA	molecular function
GO:0003993	acid phosphatase activity	IEA	molecular function
GO:0003993	acid phosphatase activity	IEA	molecular function
GO:0003993	acid phosphatase activity	IMP	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006144	purine nucleobase metabol ic process	IEA	biological process
GO:0006772	thiamine metabolic proces s	IEA	biological process
GO:0006772	thiamine metabolic proces s	ISS	biological process
GO:0008253	5'-nucleotidase activity	IEA	molecular function
GO:0008253	5'-nucleotidase activity	IDA	molecular function
GO:0009117	nucleotide metabolic proc ess	IEA	biological process
GO:0012506	vesicle membrane	IEA	cellular component
GO:0012506	vesicle membrane	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IMP	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0031985	Golgi cisterna	IEA	cellular component
GO:0033265	choline binding	IEA	molecular function
GO:0042131	thiamine phosphate phosph atase activity	IEA	molecular function
GO:0042131	thiamine phosphate phosph atase activity	ISS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0045177	apical part of cell	IEA	cellular component
GO:0046085	adenosine metabolic proce ss	IEA	biological process
GO:0046085	adenosine metabolic proce ss	IDA	biological process
GO:0051930	regulation of sensory per ception of pain	IEA	biological process
GO:0051930	regulation of sensory per ception of pain	IMP	biological process
GO:0051930	regulation of sensory per ception of pain	IMP	biological process
GO:0052642	lysophosphatidic acid pho sphatase activity	IDA	molecular function
GO:0060168	positive regulation of ad enosine receptor signalin g pathway	IMP	biological process
GO:0060168	positive regulation of ad enosine receptor signalin g pathway	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0003993	acid phosphatase activity	IMP	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006772	thiamine metabolic proces s	ISS	biological process
GO:0008253	5'-nucleotidase activity	IDA	molecular function
GO:0012506	vesicle membrane	ISS	cellular component
GO:0016311	dephosphorylation	IMP	biological process
GO:0016791	phosphatase activity	IMP	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0042131	thiamine phosphate phosph atase activity	ISS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0046085	adenosine metabolic proce ss	IDA	biological process
GO:0051930	regulation of sensory per ception of pain	IMP	biological process
GO:0051930	regulation of sensory per ception of pain	IMP	biological process
GO:0052642	lysophosphatidic acid pho sphatase activity	IDA	molecular function
GO:0060168	positive regulation of ad enosine receptor signalin g pathway	IMP	biological process
GO:0060168	positive regulation of ad enosine receptor signalin g pathway	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Female infertility	INFBASE: 24280142
Oligoasthenozoospermia	MIK: 8867597
Azoospermia	MIK: 22182811
Oligozoospermia	MIK: 22182811
Male factor infertility	MIK: 9104058
Spermatogenesis defects	MIK: 22288839
Male factor infertility	MIK: 9104058
Azoospermia	MIK: 22182811
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 22182811
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 9104058
oligo-asthenozoospermia	MIK: 8867597
Spermatogenic defects	MIK: 22288839
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
22288839	Spermatoge nic defect s		Male infertility		Show abstract
8867597	Oligo-asth enozoosper mia	62 (35 normozoo spermic men, 27 asthenozoosper mic men, oligoz oospermic)	Male infertility	PSA PAP Zn alpha 2-glycoprotein (Zn alpha 2-GP) beta-microseminoprotein (beta-MSP)	Show abstract
22182811	Azoospermi a		Male infertility	Lactoferrin Prostatic acid phosphatase Human Zinc-Alpha-2-Glycoprotein Prostate specific antigen Progestagen-associated endometrial protein Kinesin light chain 4 Kinesin light chain 4 Prolactin inducible protein Izumo sperm-egg fusion protein 1	Show abstract
9104058	Male infer tility	56 (19 with nor mospermia, 18 m ild oligospermi a, 19 severe o ligospermia)	Male infertility	PAcP	Show abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

SNPs

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

SNPs

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All