• Gene id: 54998

Gene Summary

• Gene Symbol: AURKAIP1   Gene   UCSC   Ensembl
• Aliases: AIP, AKIP, MRP-S38
• Gene name: aurora kinase A interacting protein 1
• Alternate names: aurora kinase A-interacting protein, 28S ribosomal protein S38, mitochondrial, AURKA-interacting protein, aurora-A kinase interacting protein, mitochondrial small ribosomal subunit protein mS38,
• Gene location: 1p36.33 (1375515: 1373729)     Exons: 3     NC_000001.11
• OMIM: 609183

Protein Summary

• Protein general information: Q9NWT8  
  • Name: Aurora kinase A interacting protein (AURKA interacting protein) (28S ribosomal protein S38, mitochondrial) (MRP S38) (Mitochondrial small ribosomal subunit protein mS38)
  • Length: 199  
  • Mass: 22354
  • Tissue specificity: Ubiquitously expressed and especially highly expressed in heart, skeletal muscle and testis.
• Sequence:

  MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLE
  SWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKT
  RFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK

• Structural information:
  • Interpro: IPR013177  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000342676
• Other Databases: GeneCards:  AURKAIP1  Malacards:  AURKAIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006397	mRNA processing	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045839	negative regulation of mitotic nuclear division	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray