• Gene id: 54994

Gene Summary

• Gene Symbol: GID8   Gene   UCSC   Ensembl
• Aliases: C20orf11, TWA1
• Gene name: GID complex subunit 8 homolog
• Alternate names: glucose-induced degradation protein 8 homolog, protein C20orf11, two hybrid associated protein No. 1 with RanBPM, two hybrid-associated protein 1 with RanBPM,
• Gene location: 20q13.33 (62938146: 62948474)     Exons: 5     NC_000020.11
• OMIM: 607113

Protein Summary

• Protein general information: Q9NWU2  
  • Name: Glucose induced degradation protein 8 homolog (Two hybrid associated protein 1 with RanBPM) (Twa1)
  • Length: 228  
  • Mass: 26749
  • Tissue specificity: Up-regulated in colorectal cancer tissues (at protein level). {ECO
• Sequence:

  MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGIEPSVDLETLDERIKIREMIL
  KGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTLALL
  AFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
  EPK

• Structural information:
  • Protein Domains: (25..5-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126-)
    (63..12-)
    (/note="CTLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00058"-)
  • Interpro: IPR013144  IPR024964  IPR006595  IPR006594  
  • Prosite: PS50897 PS50896
  • STRING: ENSP00000266069
• Other Databases: GeneCards:  GID8  Malacards:  GID8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq