• Gene id: 54964

Gene Summary

• Gene Symbol: C1orf56   Gene   UCSC   Ensembl
• Aliases: MENT
• Gene name: chromosome 1 open reading frame 56
• Alternate names: protein MENT, methylated in normal thymocytes protein,
• Gene location: 1q21.3 (151047750: 151051419)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene is a proto-oncogene whose promoter is methylated by DNA methyltransferase 3B (DNMT3B), which represses the proto-oncogene. However, a catalytically inactive isoform of DNMT3B is overexpressed in lymphomas, leading to hypomethylation of the proto

Protein Summary

• Protein general information: Q9BUN1  
  • Name: Protein MENT (Methylated in normal thymocytes protein)
  • Length: 341  
  • Mass: 36769
  • Tissue specificity: Plasma. Overexpressed in lymphomas. {ECO
• Sequence:

  MVPAAGALLWVLLLNLGPRAAGAQGLTQTPTEMQRVSLRFGGPMTRSYRSTARTGLPRKTRIILEDENDAMADAD
  RLAGPAAAELLAATVSTGFSRSSAINEEDGSSEEGVVINAGKDSTSRELPSATPNTAGSSSTRFIANSQEPEIRL
  TSSLPRSPGRSTEDLPGSQATLSQWSTPGSTPSRWPSPSPTAMPSPEDLRLVLMPWGPWHCHCKSGTMSRSRSGK
  LHGLSGRLRVGALSQLRTEHKPCTYQQCPCNRLREECPLDTSLCTDTNCASQSTTSTRTTTTPFPTIHLRSSPSL
  PPASPCPALAFWKRVRIGLEDIWNSLSSVFTEMQPIDRNQR

• Structural information:
  • Interpro: IPR029292  
  • STRING: ENSP00000357922
• Other Databases: GeneCards:  C1orf56  Malacards:  C1orf56

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0042127	regulation of cell population proliferation	IMP	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)