• Gene id: 54963

Gene Summary

• Gene Symbol: UCKL1   Gene   UCSC   Ensembl
• Aliases: UCK1L, URKL1
• Gene name: uridine-cytidine kinase 1 like 1
• Alternate names: uridine-cytidine kinase-like 1, UCK1-LIKE,
• Gene location: 20q13.33 (63956446: 63939828)     Exons: 20     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a uridine kinase. Uridine kinases catalyze the phosphorylation of uridine to uridine monophosphate. This protein has been shown to bind to Epstein-Barr nuclear antigen 3 as well as natural killer lytic-associated molecu
• OMIM: 610866

Protein Summary

• Protein general information: Q9NWZ5  
  • Name: Uridine cytidine kinase like 1 (EC 2.7.1.48)
  • Length: 548  
  • Mass: 61141
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKRTTSQCKSEPPLLRTS
  KRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHN
  NFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIF
  VDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPSFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQL
  EERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCV
  VQTPQGQDYAGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIGTILIQTNQLTGEPELHYLRLPKDISDDHVI
  LMDCTVSTGAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNF
  GDRYFGTDAVPDGSDEEEVAYTG

• Structural information:
  • Interpro: IPR027417  IPR000836  IPR006083  IPR029057  IPR029933   IPR000764  
  • CDD: cd06223 cd02023
  • STRING: ENSP00000346155
• Other Databases: GeneCards:  UCKL1  Malacards:  UCKL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IBA	molecular function
GO:0004849	uridine kinase activity	IEA	molecular function
GO:0009116	nucleoside metabolic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004849	uridine kinase activity	IEA	molecular function
GO:0043097	pyrimidine nucleoside salvage	TAS	biological process
GO:0004849	uridine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0044211	CTP salvage	IEA	biological process
GO:0044206	UMP salvage	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq