• Gene id: 54962

Gene Summary

• Gene Symbol: TIPIN   Gene   UCSC   Ensembl
• Gene name: TIMELESS interacting protein
• Alternate names: TIMELESS-interacting protein, CSM3 homolog,
• Gene location: 15q22.31 (56961049: 56938198)     Exons: 7     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is part of the replisome complex, a group of proteins that support DNA replication. It binds TIM, which is involved in circadian rhythm regulation, and aids in protecting cells against DNA damage and stress. Two pseudogene
• OMIM: 610716

Protein Summary

• Protein general information: Q9BVW5  
  • Name: TIMELESS interacting protein
  • Length: 301  
  • Mass: 34555
• Sequence:

  MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTVKRNIPKLDAQRLISE
  RGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPIL
  HEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTL
  GNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEA
  R

• Structural information:
  • Interpro: IPR012923  IPR040038  
  • DIP: 53658
  • STRING: ENSP00000261881
• Other Databases: GeneCards:  TIPIN  Malacards:  TIPIN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000076	DNA replication checkpoint	IMP	biological process
GO:0031573	intra-S DNA damage checkpoint	IMP	biological process
GO:0033262	regulation of nuclear cell cycle DNA replication	TAS	biological process
GO:0048478	replication fork protection	IBA	biological process
GO:0031298	replication fork protection complex	IBA	cellular component
GO:0000076	DNA replication checkpoint	IBA	biological process
GO:0043111	replication fork arrest	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0000076	DNA replication checkpoint	IEA	biological process
GO:0048478	replication fork protection	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0009411	response to UV	IEA	biological process
GO:0044770	cell cycle phase transition	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray