• Gene id: 5496

Gene Summary

• Gene Symbol: PPM1G   Gene   UCSC   Ensembl
• Aliases: PP2CG, PP2CGAMMA, PPP2CG
• Gene name: protein phosphatase, Mg2+/Mn2+ dependent 1G
• Alternate names: protein phosphatase 1G, PP2C-gamma, protein phosphatase 1C, protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, protein phosphatase 2, catalytic subunit, gamma isoform, protein phosphatase 2C gamma isoform, protein phosphatase 2C isoform g,
• Gene location: 2p23.3 (27409590: 27381198)     Exons: 10     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylatio
• OMIM: 605119

Protein Summary

• Protein general information: O15355  
  • Name: Protein phosphatase 1G (EC 3.1.3.16) (Protein phosphatase 1C) (Protein phosphatase 2C isoform gamma) (PP2C gamma) (Protein phosphatase magnesium dependent 1 gamma)
  • Length: 546  
  • Mass: 59272
  • Tissue specificity: Widely expressed. Most abundant in testis, skeletal muscle, and heart.
• Sequence:

  MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYL
  PDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNEEAALLHEEAT
  MTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAG
  QVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEEEDGYSSEEAENEEDEDDTEE
  AEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELA
  RIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQ
  EVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEV
  LSTEGAEENGNSDKKKKAKRD

• Structural information:
  • Protein Domains: (26..50-)
    (/note="PPM-type-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01082"-)
  • Interpro: IPR015655  IPR000222  IPR036457  IPR001932  
  • Prosite: PS01032 PS51746
  • CDD: cd00143
  • DIP: 29404
  • STRING: ENSP00000342778
• Other Databases: GeneCards:  PPM1G  Malacards:  PPM1G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004724	magnesium-dependent protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0043169	cation binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007050	cell cycle arrest	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray