• Gene id: 54959

Gene Summary

• Gene Symbol: ODAM   Gene   UCSC   Ensembl
• Aliases: APIN
• Gene name: odontogenic, ameloblast associated
• Alternate names: odontogenic ameloblast-associated protein, odontogenic, ameloblast asssociated,
• Gene location: 4q13.3 (70195727: 70204575)     Exons: 18     NC_000004.12
• OMIM: 614843

Protein Summary

• Protein general information: A1E959  
  • Name: Odontogenic ameloblast associated protein (Apin)
  • Length: 279  
  • Mass: 30777
  • Tissue specificity: Expressed in the junctional epithelium of healthy teeth. In periodontitis, absent in the pocket epithelium of the diseased periodontium but is detected in the gingival crevicular fluid. {ECO
• Sequence:

  MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQF
  SLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYM
  VLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYL
  QKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

• Structural information:
  • Interpro: IPR026802  
  • STRING: ENSP00000379401
• Other Databases: GeneCards:  ODAM  Malacards:  ODAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042475	odontogenesis of dentin-containing tooth	IEP	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0031214	biomineral tissue development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0009611	response to wounding	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006954	inflammatory response	IDA	biological process
GO:0099512	supramolecular fiber	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0032956	regulation of actin cytoskeleton organization	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0060054	positive regulation of epithelial cell proliferation involved in wound healing	IEP	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)